(data stored in ACNUC7421 zone)

EMBL: AP011115.PE656

AP011115.PE656       Location/Qualifiers
FT   CDS_pept        678720..679481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48903"
FT                   /db_xref="GOA:C1ASX1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX1"
FT                   /protein_id="BAH48903.1"
FT                   /translation="MSKAQHVGRLFLVSVLAALAVCGVSVAASAAPPAVTGKILAPALT
FT                   PASGQVVGIAHPVVVRFTSPVPDRALAERGVRITPSTPVPGQFSWIDDRTLQWNPDRFW
FT                   PANTAVTVEAAGARSQFQVGDALVAVANTTTHQFTVSINDQIVQTMPASMGKPGYETPL
FT                   GTFPVIEQFRDMIMDSSTYGVPIDDEEGYRLYVEYATRITWGGIFVHAAPWSVGSQGFE
FT                   NVSHGCINLSTENARWFYDNAKIGDPVIVTS"
     atgtcgaaag ctcagcacgt cggacgtctg ttcctcgtct cggtactcgc ggcacttgcc        60
     gtgtgcggag tgagcgtcgc cgcgtcggcg gcgcccccgg ccgtcaccgg gaagatcctc       120
     gcgccggccc tcacccccgc gagcggtcag gtcgtcggca tcgcccatcc ggtcgtcgtc       180
     cggttcacgt ccccggttcc cgatcgcgcg ctcgccgagc gtggtgtccg gatcaccccg       240
     tcgacgcccg tacccgggca gttctcctgg atcgacgacc gcaccctgca atggaacccg       300
     gaccgcttct ggccggcgaa caccgcagtg accgtcgagg cggcgggcgc gagatcgcag       360
     ttccaggtcg gtgacgcact cgtcgcagtc gcgaacacga cgacgcacca gttcaccgtg       420
     agcatcaacg accagatcgt gcagacgatg cccgcgtcga tgggcaaacc cggatacgag       480
     acaccactcg ggaccttccc cgtcatcgag cagttccgcg acatgatcat ggactcgtcg       540
     acgtacggtg tcccgatcga cgacgaggag ggctaccgcc tctacgtcga atacgccacc       600
     cgcatcacgt ggggcgggat cttcgtgcac gccgcaccgt ggtcggtggg ttcacagggc       660
     ttcgagaacg tcagccacgg ctgcatcaac ctcagcaccg agaacgcgcg gtggttctac       720
     gacaacgcca agatcggcga ccccgtcatc gtcacgtcgt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page