(data stored in ACNUC7421 zone)

EMBL: AP011115.PE662

AP011115.PE662       Location/Qualifiers
FT   CDS_pept        complement(684462..685466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06620"
FT                   /product="putative chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48909"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX7"
FT                   /protein_id="BAH48909.1"
FT                   /translation="MGSTAIIERTGDHRTVVTPQPPAAESEHSQPEGDMFDVRQTETAA
FT                   LLDDAAVVVEEELGPTGRPTREVPEPAPLPSHGPAKIVAMCNQKGGVGKTTSTINLGAS
FT                   LAEYGRRVLLVDLDPQGALSAGLGVAHNDLELTVHNLLVEPRVSIDDVLMRTRVEGLDL
FT                   LPSNIDLSAAEIQLVTEVGREQTLGRVLHPVLDRYDYVLIDCQPSLGLLTVNALACADS
FT                   VIIPMECEYFSLRGLALLNDTVEKVHDRLNPRLELAGIVVTMFDARTLHAREVMARVVE
FT                   VFGDLVYDTVINRTVRFPETSVAGEPITTWAPKSTGAEAYRALAREVIHRSGR"
     gtgggatcga cagcgatcat cgagagaaca ggggatcatc ggaccgtggt gacaccgcag        60
     ccgccagcgg cggagtcaga gcactcgcaa ccggagggcg acatgttcga cgtgcggcaa       120
     accgaaaccg cagccttgct cgacgacgct gccgtggtcg tggaggagga gctcggcccc       180
     accggacggc cgacgcgtga ggtgccggaa cccgccccgt tgccctcgca cggcccggcc       240
     aagatcgtcg cgatgtgcaa ccagaagggt ggcgtcggaa agacgacgtc gacgatcaac       300
     ctgggtgcgt ccctggccga atacggccga cgggtcctgc tcgtcgacct cgatccccag       360
     ggggcgctgt ccgcgggcct cggcgtcgcg cacaacgacc tcgaactgac cgttcacaat       420
     ctgctcgtcg aaccgcgcgt gtcgatcgac gacgtactga tgcggacacg cgtcgagggg       480
     ctcgaccttc tgccgagcaa catcgacctg tcggcggcgg agatccagct cgtcaccgag       540
     gtggggcgcg agcagacgct cgggcgcgtg ctgcatcccg tgctcgaccg ctacgactac       600
     gtcctcatcg attgccagcc gtccctcggt ctgctcacgg tcaacgcgct ggcctgcgcg       660
     gactcggtca tcatcccgat ggagtgcgag tacttcagct tgcgcggcct ggcgctgctc       720
     aacgacacgg tcgagaaggt ccacgaccgg ctcaacccgc ggctcgaact cgccggcatc       780
     gtcgtcacga tgttcgacgc gcggactctg cacgcgcgcg aggtgatggc ccgcgtggtg       840
     gaggtgttcg gggatctcgt ctacgacacc gtcatcaacc ggacggtgcg attccccgag       900
     acgtccgtcg ccggggaacc gatcaccacc tgggcgccca agtcgaccgg cgccgaggcg       960
     taccgtgcgc tggcacgcga ggtcattcac cggtccggcc ggtaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page