(data stored in ACNUC7421 zone)

EMBL: AP011115.PE665

AP011115.PE665       Location/Qualifiers
FT   CDS_pept        complement(688219..689169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06650"
FT                   /product="putative channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48912"
FT                   /db_xref="GOA:C1ASY0"
FT                   /db_xref="InterPro:IPR021522"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY0"
FT                   /protein_id="BAH48912.1"
FT                   /translation="MISLRQHAISIAAIFLALAIGVVMGSGLLSSGLVSGLRDDKADLQ
FT                   TDLENASERNNQLTEQLNSADGFDSAVGGRVVADSLAQRTVMVVTTPDADPADLDGVNR
FT                   MIAQAGGSVTGRVSLTDSFVDATGGDRLRTVVNNVIPAGVTLKTGAVDQGSLAGDLLGS
FT                   VLMLGKETGQPQSSAQEMALALETLRGAGFVSYDDGAVQPAQVAVVLTGDRDVEDGVSG
FT                   NRGAVVARFAGALDSRGAGAVLAGRPASAQGNGAVAVARADAALSAALTTIDNIDREAG
FT                   KITVPLALQEQLNGGAGRYGTGPGTTGVTVGATPA"
     gtgatttctc tgcgtcaaca tgccatttcc atagcggcga tcttcctggc tctggcaatc        60
     ggcgtggtca tgggctccgg cctgttgtcg agtggtctcg tgtcggggct gcgcgacgac       120
     aaagcggacc tgcagaccga cctggagaac gcaagcgaac gtaacaacca actgaccgag       180
     cagctgaact cggccgacgg tttcgattcc gcggtgggcg gccgcgtggt cgccgactcg       240
     ctcgcgcagc gcaccgtgat ggtcgtgacg acccccgatg ccgacccggc cgacctcgac       300
     ggggtcaacc ggatgatcgc gcaggcaggg ggttcggtga ccgggcgggt gtcgttgacc       360
     gactcgttcg tcgacgccac gggcggcgac cggttgcgga cggtcgtcaa caacgtgatc       420
     cccgcgggtg tcacgttgaa gaccggggcc gtcgaccagg gcagcctcgc aggcgacctg       480
     ctgggttcgg tcctcatgct cggcaaggag acgggccagc cgcagagttc cgcccaggag       540
     atggcgctgg ccctcgagac gctccgcggc gccgggttcg tcagctacga cgacggcgcc       600
     gtccagcctg cgcaggtcgc ggtcgtgctg accggagatc gggacgtgga ggacggcgtc       660
     agtggcaacc gcggcgcggt cgtggcccgg ttcgcgggcg cgctggactc gcgcggtgcc       720
     ggggcggtgc tcgccggacg tccggcctcc gcccagggca acggcgcggt cgccgtggca       780
     cgggccgacg ccgccctgtc ggcggcgctc acgacgatcg acaacatcga tcgggaagcg       840
     ggcaaaatca ccgttccgct cgcgctgcag gagcaactga acggcggcgc gggccggtac       900
     ggcaccggac ccggcaccac cggagtcacc gtgggggcca ccccggcgta g                951
//

If you have problems or comments...

PBIL Back to PBIL home page