(data stored in ACNUC7421 zone)

EMBL: AP011115.PE666

AP011115.PE666       Location/Qualifiers
FT   CDS_pept        complement(689166..690350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06660"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48913"
FT                   /db_xref="GOA:C1ASY1"
FT                   /db_xref="InterPro:IPR022215"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY1"
FT                   /protein_id="BAH48913.1"
FT                   /translation="MKMPALLSRNTETLPGVSGIARVDRNTAKLLRRVGPGDIVVLDEL
FT                   DLDRGTADALVKAGVLAVINASPSISGRYPNLGPEVIVANGILLVDSAGAEIFKSIKDG
FT                   SKVRVNGGGVYSGERRIAKGDEQTEAEISDRMIEAKTGLVDHLEAFSGNTIEFIRTESP
FT                   LLIDGVGVPDVDVDMKERHVVIVSDGPDHASDLKNLKPFIKEYSPILIGVGAGADVLKS
FT                   AGYRPDLIVGDPEDITSATLKSGAEVVLPADQDGHAPGLSRIQDLGIGAMTFPASGSPS
FT                   DLALLLADHHGASLIVTVGSTVSLDEFFDRGRRDSNPSAFMTRLKVGPKLVDAKAVATL
FT                   YRSRVSGSAIALLVLAALVAVIVALVVSNVGGEALDWAVATWNSFALWVQGFFK"
     atgaagatgc cggcactgct gtcacgtaac accgaaactt tgcccggggt cagcggcatc        60
     gccagggtgg atcgcaacac ggccaagttg ctgcgccgcg tcggacccgg tgacatcgtc       120
     gttctcgacg agctcgacct cgaccgcgga accgcggacg ccctggtgaa ggccggcgtt       180
     ctcgcagtga tcaacgcgtc gccgtcgatc tcggggcggt atcccaacct cggcccggag       240
     gtgatcgtcg ccaacgggat cctgctggtg gattcggcgg gcgccgagat cttcaagagc       300
     atcaaggacg gcagcaaggt ccgggtgaac gggggaggtg tctactccgg ggaacggcgc       360
     atcgccaagg gcgacgaaca gaccgaggcg gagatctccg accggatgat cgaggcgaag       420
     accggtctgg tcgaccacct cgaggcgttc tccggcaaca ccatcgagtt catccgcacc       480
     gagagtccgt tgctgatcga cggggtcggc gtgcccgacg tcgacgtcga catgaaggaa       540
     cggcacgtcg tgatcgtgtc cgacggcccg gaccacgcgt ccgacctgaa gaacctcaag       600
     ccgttcatca aggagtactc accgatcctc atcggcgtcg gggcaggcgc cgacgtcctg       660
     aagtcggcgg gctaccgccc cgacctcatc gtcggcgacc ccgaggacat caccagcgcg       720
     acgctgaagt cgggcgccga ggtggtgctg cccgccgacc aggacggtca cgcacccggt       780
     ctgtcgcgca tccaggacct cggcatcggg gcgatgacgt ttcccgcgtc cgggtccccg       840
     tccgacctgg ctctgctgct ggccgaccac cacggcgcgt cgctgatcgt cacggtcggc       900
     agcaccgtct cgctcgacga gttcttcgac cgcggccgcc gcgacagcaa cccgtcggcg       960
     ttcatgaccc ggctgaaggt cgggccgaaa ctggtggacg cgaaggccgt ggcgacgctg      1020
     taccgcagcc gggtgtcggg cagcgcgatc gcgctgctcg tcctcgccgc tctcgtggcc      1080
     gtcatcgtgg ccctggtcgt gtccaacgtg ggtggtgagg cactcgactg ggccgtcgcg      1140
     acgtggaaca gcttcgcgtt gtgggttcag gggttcttca agtga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page