(data stored in ACNUC7421 zone)

EMBL: AP011115.PE670

AP011115.PE670       Location/Qualifiers
FT   CDS_pept        complement(694025..694312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48917"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY5"
FT                   /protein_id="BAH48917.1"
FT                   /translation="MFVTRFAVCVSDRDGLALCPMSTPIPRPGAHLPGPPQSVDPEKIH
FT                   TEVDGLLSRLGAVEPDPDDEHGAGVIPRKAHLLEKAHDVLVEALATVDKI"
     ttgttcgtca cgcgattcgc tgtatgcgta tcggatcgcg atggactagc gttgtgcccg        60
     atgagcacgc caataccgcg cccgggagcc catctacctg ggcctcctca gagtgtcgac       120
     cccgagaaga tccacacgga ggtcgacgga ttgttgtcgc ggctcggagc cgtcgaaccc       180
     gatcccgacg acgaacacgg tgccggcgtc atcccgcgca aggctcacct tctcgagaag       240
     gcgcacgacg tgctggtgga ggccttggcc accgtggaca agatctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page