(data stored in ACNUC7421 zone)

EMBL: AP011115.PE672

AP011115.PE672       Location/Qualifiers
FT   CDS_pept        complement(695323..696330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48919"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY7"
FT                   /protein_id="BAH48919.1"
FT                   /translation="MVCVKGMTVSESDDGRRSFRGGGASQSGRGGASQSGRGGASHNDR
FT                   GASGGNRGGAGGSGRGGSSGGPRRDSRDNRGGAGGDRRGGGPRRGGEGGFAPRGREGDR
FT                   PQRQQARPDEPDLPENVEAGELDPAVRRDLLSLDKTNANTVARHLVMAGKLVDDDPRLA
FT                   LAHARAARQRAGRIAIVREAAGITAYHAGEWAEALSELRAARRMAGGPGLLAVMADCER
FT                   GLGRPERAIELGRSEEAAALSGDEAAELRMVVAGARMDLGQFDQAVVTLQTPDLDAART
FT                   GPGAARLFYAYADALVAAGRIEDGLKWFLNSAAADLEGDTDAEERVAELTGDDQ"
     gtggtttgtg tgaaaggaat gactgtgtcg gagagtgacg acggacgtcg gtccttccgc        60
     ggaggcggtg cctcccaaag tggtcgaggc ggtgcctccc aaagtggtcg aggcggcgcc       120
     tctcataacg atcgcggtgc gtccggtggt aaccgtggcg gcgccggcgg ttccggtcgt       180
     ggtggctcgt ccggtggtcc ccgtcgcgat tcgcgcgaca accgtggcgg tgccggtggc       240
     gatcgtcgcg gtggcggacc ccgtcgtggc ggcgagggcg gcttcgcgcc tcgcggacgt       300
     gaaggcgacc gtccgcagcg gcagcaggcc cgtccggacg aaccggatct gcccgagaac       360
     gtcgaggccg gcgagctcga tcccgctgtc cgccgcgacc tgctgagcct ggacaagacg       420
     aacgcgaaca cggttgcgcg tcacctggtg atggccggca agctcgtcga cgacgatccg       480
     cgtcttgcgc tcgcgcatgc ccgcgccgcg cgccagcgtg cgggccgtat cgctatcgtg       540
     cgtgaggccg cgggcatcac cgcatatcac gccggcgaat gggcggaggc gctgtcggag       600
     ttgcgcgctg ctcgccgcat ggcgggcggt cccggactgc tcgcggtgat ggcggactgc       660
     gagcgtggac tcggccgccc ggagcgtgcg atcgaactcg ggcgaagcga ggaagccgca       720
     gccctgtcgg gtgacgaggc tgccgagctg cgcatggtgg tcgccggagc tcggatggac       780
     ctcggacagt tcgatcaggc cgttgtcaca ctgcagaccc ccgatctcga cgccgcacgg       840
     accggacccg gtgcggctcg tctgttctac gcgtacgccg atgccctggt ggcggccggt       900
     cgtatcgagg acggactcaa gtggttcctc aactccgctg ccgcggatct cgagggtgac       960
     accgacgcgg aggagcgtgt ggccgagctg accggagacg atcagtga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page