(data stored in ACNUC7421 zone)

EMBL: AP011115.PE675

AP011115.PE675       Location/Qualifiers
FT   CDS_pept        704186..704974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06750"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48922"
FT                   /db_xref="GOA:C1ASZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ0"
FT                   /protein_id="BAH48922.1"
FT                   /translation="MGRIIHHTMNSPSDELRSAMTDAAAIDIRDLHVRRGRNEVLHGID
FT                   VQVASGSITGLLGPSGCGKTTLMRCVVGTQIVESGTVTVLGSPAGSVSLRSRVGYVTQS
FT                   PSVYADLTVRKNVAYFAALYGQPSSAVTEAVDAVGLTRFATQKAADLSGGQLGRVSLAC
FT                   ALVARPEILVLDEPTVGLDPLLRVELWERFEELAAAGTTLLVSSHVMDEAEHCASLLLM
FT                   RDGYVLAQVSPGGLREQTGETSLEDAFLNLIRASHVGSEN"
     gtgggtcgca taattcatca cacaatgaat tcacccagtg atgaattgag gtccgccatg        60
     accgacgccg cagcgatcga catccgagat ctacacgtgc gcagaggcag gaacgaagtg       120
     ctgcacggca ttgacgtcca ggttgcgagc ggatccatca ccggtctcct cggaccttcc       180
     ggatgcggaa agaccacgct gatgcggtgc gtggtcggca cccagatcgt ggaatccggg       240
     accgtcaccg tgctggggtc ccccgcaggc tcggtctcgt tgcgaagccg cgtcgggtac       300
     gtcacccagt cccccagcgt gtacgccgac ctcacggtcc ggaagaatgt cgcctatttc       360
     gccgcactct acggtcagcc gtcgagcgcg gtcaccgaag ccgtcgatgc ggtggggctg       420
     acacgcttcg ccacccagaa ggcggccgat ctgtcgggcg ggcagctggg ccgggtcagc       480
     ctcgcatgcg cactggtggc gcgccccgag atcctcgtgc tcgacgaacc caccgtcggc       540
     ctggaccccc tcctgcgggt cgaactctgg gagcgattcg aggaactcgc cgccgcggga       600
     accaccctgc tggtgtcgag ccacgtcatg gacgaggccg agcactgcgc gtcgctcctg       660
     ctcatgcgcg acggctacgt tctcgcgcag gtttcccccg gcgggctccg cgaacagacg       720
     ggcgagacga gcctcgaaga cgccttcctg aacctcatcc gggcatcaca cgtcggaagt       780
     gaaaactga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page