(data stored in ACNUC7421 zone)

EMBL: AP011115.PE679

AP011115.PE679       Location/Qualifiers
FT   CDS_pept        complement(706604..709645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06790"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48926"
FT                   /db_xref="GOA:C1ASZ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ4"
FT                   /protein_id="BAH48926.1"
FT                   /translation="MRAGGSEACVTVRESGRVFVGLNTETVMGPIRRVVATAQNGLEVV
FT                   RLGGLETDLTTSPFEVVERAPMYRLRRYFPDTDPAEAGPPIVLVPPMMMSADVYDVTRD
FT                   QGAVGILRSMGIDPWVVDFGSPDSEEGGWDRNLADHIVAISEIIDQVRSHTGRDVYLSG
FT                   YSQGGMFAYQAAAYRRSRNIAGLVTFGSPVDTLAGLPFGIPAGFATDAAGFLADHVFNR
FT                   LAVSGWMARTGFQLLDPVKTLKSRLDFLRQLHDREALLPREQQRRFLATEGWVAWSGPA
FT                   VAELLKQFIVHNRMMTGGFVIKDQVVSLAELTCPVLAFVGEVDDIGQPLAVRGIRRAAP
FT                   RANVYESTLRAGHFGLVVGSAAATHTWPTTGKWVLWNEGLGPRPTNIELMRYDEHFGSE
FT                   SGVSISDRIIHTVASVAEVGVGVGKGISDFASGALRGTMELSGEATRALPRLARLGQIQ
FT                   PHTQISLSRLLAEQRRKAPGGECFLFDNRVHTYEAVNQRIDNVVRGLIQASVRPAAHVG
FT                   VVMQTRPSALAAIVALSRLGAVAVLLPPGREVHSAIRIDGVERIVTDPENLDAAIATGM
FT                   QVLVLGGGAQRDLDVDPSANVVDLEKIDPGAVTLPGWYRPDPGLARELAFIICSESNGH
FT                   WETKQITNYRWALSAFGTASAADLDRGDTVYCLAPLHHSSSLLAAIGGAVAGGSRIALS
FT                   RGLDAERFAEEVHRYGVTVVSYTWTMMREILDAENLALDGSHPVRLFIGSGMPQGLWRR
FT                   TTERFAPAKVLEFYASTEGDVVLANVAGAKVGAKGRPLPGSAEVRLAAYDPISGRLLED
FT                   EQGFIRECEDDEVGLLLGRAGVHAEMSGGAMRGIFAAGDAWIPTENLFCRDADGDYWLV
FT                   DHRKTVIATPRGAVFTQPIVDALGSVDRVDLAVAYGVEAGGRTLAVAAFTLRDGRPPRL
FT                   AEISDALDALAPALRPDIIQVVGDIPLGSSYRPNADALSAAGLPKPGTRVWYVDPESQQ
FT                   YRRLTKAVAAEFQDGSAGVPAGAR"
     gtgagggcgg gcggcagcga ggcgtgcgtc acggttcgag agtctgggag agtgttcgtg        60
     ggactgaata ccgaaacggt gatgggcccg atccgtcgcg tggtggcgac ggcgcagaac       120
     gggctggagg tggtccgtct cggtgggctc gagacggacc tcaccacatc gccgttcgag       180
     gtggtcgaac gcgcaccgat gtatcggctg aggcggtatt tccccgacac ggatccggcc       240
     gaggccggac ccccgatcgt cctggtcccg ccgatgatga tgtcggccga cgtctacgac       300
     gtgacacggg accagggtgc ggtcggcatc ctgcgctcga tgggaatcga cccctgggtg       360
     gtcgacttcg gatcgccgga ttccgaagag ggcggctggg atcggaatct cgccgaccac       420
     atcgtcgcga tcagcgagat catcgatcag gtgcggtcgc acaccggtcg ggacgtctat       480
     ctctccggat attcgcaggg cggcatgttc gcctatcagg ccgccgcgta ccgccgcagc       540
     cgcaacatcg ccggactcgt gacgttcggc agcccggtcg acacgctcgc cgggctgccg       600
     ttcgggatcc cggcgggttt cgcgaccgac gctgcgggct tcctcgcgga ccacgtcttc       660
     aaccggctcg cggtatcggg atggatggcc cgcaccgggt ttcagctcct cgaccccgtc       720
     aagacactga agtcgaggtt ggatttcctc cgtcagctgc acgacaggga agcgctgttg       780
     ccgcgggagc agcagcggcg gttcctcgcg accgagggct gggttgcgtg gtccggtccg       840
     gctgtcgccg agttgctcaa gcagttcatc gtgcacaacc gcatgatgac cggcgggttc       900
     gtgatcaagg accaggtggt gtcgctcgcg gagttgacct gccccgtcct cgcgtttgtg       960
     ggggaggtcg acgacatcgg tcagccgttg gccgtccgcg gcatccgccg ggccgcccca      1020
     cgcgcgaacg tgtacgaatc gaccttgcgg gcagggcatt tcggcctcgt cgtcggttcg      1080
     gccgcagcga cgcacacgtg gcccacgacc ggcaagtggg ttctgtggaa cgaggggctg      1140
     ggtccgcgcc ccaccaacat cgaactcatg cgctacgacg agcacttcgg tagcgaatcc      1200
     ggggtctcga tcagcgatcg catcatccac accgtggcgt cggtcgccga ggtcggcgtc      1260
     ggtgtcggca aggggatcag cgacttcgcg tccggcgcgc tgcgcggcac gatggaactg      1320
     tccggcgagg ccacacgggc gctgccccgg ttggcccggc tcggccagat ccagccacac      1380
     acccagatct cgctcagccg gttgctggcc gagcagcgcc ggaaggcgcc gggcggcgag      1440
     tgcttcctct tcgacaatcg cgtgcacacc tacgaggcgg tcaatcagcg gatcgacaac      1500
     gtggtgcgtg gcctgattca ggccagtgtc cgtcccgccg cgcatgtcgg cgtcgtgatg      1560
     cagacgcgcc cgagcgcgct cgccgccatc gtcgcgctgt cccgtctcgg tgccgtggcg      1620
     gtcctcctgc cgcccgggcg ggaagtgcac agcgccatcc gcatcgacgg tgtcgagcgc      1680
     atcgtcaccg atccggagaa tctggacgcc gcgatcgcca ccggcatgca ggtcctggta      1740
     ctgggcggcg gcgcccagcg cgacctcgac gtggatccgt cggcgaacgt cgtcgacctc      1800
     gagaagatcg accccggcgc cgtgacgctg ccgggctggt accggcccga tcccggtctg      1860
     gcccgcgaac tggcgttcat catctgcagt gagtccaacg ggcactggga gaccaagcag      1920
     atcacgaact atcggtgggc gctgtcggcg ttcggaacgg cctcggccgc cgatctcgat      1980
     cgtggtgaca ctgtgtactg ccttgcgcct ctgcatcatt cgtcgagtct gctcgccgcg      2040
     atcggtggcg ccgtggcggg tggatcccgg atcgcgctct cgcgcggact cgacgccgag      2100
     cggttcgccg aagaagtcca tcgctacggc gtgacggtgg tcagctacac gtggacgatg      2160
     atgcgcgaga tcctcgacgc cgagaacctc gcgctcgacg gaagtcaccc cgtccggctg      2220
     ttcatcgggt ccggcatgcc gcaggggttg tggcgccgca cgacggaacg gttcgcaccg      2280
     gcgaaggtcc tcgagttcta cgcgtccacc gagggcgacg tggttctcgc gaacgtcgca      2340
     ggcgcgaagg tcggggcgaa ggggcgaccc ctgcccggga gcgccgaggt gcggctggcg      2400
     gcctacgacc cgatctccgg ccggctgctg gaggacgagc agggattcat ccgcgaatgc      2460
     gaggacgacg aggtcggtct gctcctcggc agggcgggcg tgcacgccga gatgtccggc      2520
     ggcgcgatgc ggggaatatt cgccgcgggc gacgcgtgga ttccgacgga gaacctcttc      2580
     tgccgcgacg ccgacgggga ctactggctg gtcgatcaca ggaagaccgt gatcgcgact      2640
     ccccggggcg cggtgttcac ccagccgatc gtcgacgcgc tcgggtccgt cgatcgggtc      2700
     gacctcgcgg tggcctacgg ggtggaggcc ggcggccgca cgctcgccgt tgccgcgttc      2760
     actctccggg acgggcggcc gccgagactg gcggagatct cggacgcgct cgacgcgctt      2820
     gctcccgcgc tgcgacccga catcatccag gtggtcgggg acatcccgct ggggtcctcg      2880
     taccgaccga atgccgatgc cctgagcgct gccggactgc ccaagccggg aacccgtgtg      2940
     tggtatgtcg atccggaatc gcagcagtac cggcggctga ccaaggcggt tgccgccgag      3000
     ttccaggacg gctccgccgg agtgcccgcc ggtgcgcggt ag                         3042
//

If you have problems or comments...

PBIL Back to PBIL home page