(data stored in ACNUC7421 zone)

EMBL: AP011115.PE68

AP011115.PE68        Location/Qualifiers
FT   CDS_pept        complement(59204..59482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48315"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS66"
FT                   /protein_id="BAH48315.1"
FT                   /translation="MTVPTTNDKPAVHCGGEDRGHRAGNRVVVAAGAFAGHATMSIGML
FT                   VHELSVLVAIVNPMRLFVGGVSAPHITRRPRRARGSEPGFPIRRSNR"
     atgacggtgc ccacaacgaa tgacaaaccc gcggtgcact gtggcggtga agatcgcgga        60
     caccgcgccg gcaaccgtgt cgtggtggcg gcgggcgcct tcgccggcca cgccacgatg       120
     tccatcggga tgctcgtgca cgaactgtcg gtgctcgtgg ccatcgtcaa cccgatgcgc       180
     ctgttcgtcg gaggggtatc ggctccgcac atcacgcggc gcccccggcg cgcgagaggg       240
     tccgaaccgg gttttccgat ccgacgatcg aaccgctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page