(data stored in ACNUC7421 zone)

EMBL: AP011115.PE688

AP011115.PE688       Location/Qualifiers
FT   CDS_pept        complement(718328..718726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48935"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT03"
FT                   /protein_id="BAH48935.1"
FT                   /translation="MTEVRDVVAAASQLTDAEFLQVVRAVAAGRPGLGALLAAVDVGAA
FT                   IPTEDPVTAEVVPHVVPGAPAPDYTPGGVPTFDRVRERIEGRFGTATGSSELAHDSPSG
FT                   QSLEEAWEKREKAGKAKLDEIRRSLGKQ"
     atgaccgagg tgcgcgacgt cgtggcggcg gcgagccagt tgaccgacgc cgagttcctc        60
     caggtggtac gcgcggtggc cgccggacgt ccgggtctcg gtgcgctgct cgcggccgtg       120
     gacgtgggtg cggcgattcc gacggaggat ccggtgaccg cggaggtcgt gccgcacgtc       180
     gtaccgggtg cgccggcgcc ggactacacc ccggggggtg tcccgacgtt cgaccgcgtg       240
     cgtgagcgga tcgaaggacg gttcgggacg gcgacgggct cctcggaact cgcgcacgac       300
     agcccgtcgg ggcagtcgct cgaggaggcg tgggagaagc gggagaaggc gggtaaggcc       360
     aagctcgacg agatccggcg gtcgctcggc aagcagtga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page