(data stored in ACNUC7421 zone)

EMBL: AP011115.PE69

AP011115.PE69        Location/Qualifiers
FT   CDS_pept        59502..59858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48316"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS67"
FT                   /protein_id="BAH48316.1"
FT                   /translation="MGPIELVRAYDARGTKKTSPTFLVDRLWPRGIAKADLDCDAWIKE
FT                   VAPSTELRTWFGHQADRFPEFRTRYLQELDTNRTAAQPIVEAARNGTVVLLYSAKDLEH
FT                   NQAVVLREWISNQF"
     atgggcccga tcgagttggt gcgagcctat gacgctcgcg gcaccaagaa gacatcgcca        60
     accttcttgg tagatcgact ctggccacgg ggcatcgcga aagcggacct cgactgcgac       120
     gcctggatca aggaggtggc gcccagtacg gaactgcgga cctggttcgg ccaccaggcg       180
     gatcggtttc cggagttccg cacacgctat cttcaagaac ttgataccaa tcgcactgcc       240
     gcccagccga tcgtcgaggc ggcgcggaac gggactgtgg tgctgctgta ttcggcgaag       300
     gacctcgagc acaaccaagc cgtggtcttg cgcgagtgga tctcgaatca gttctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page