(data stored in ACNUC7421 zone)

EMBL: AP011115.PE695

AP011115.PE695       Location/Qualifiers
FT   CDS_pept        725106..725489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48942"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT10"
FT                   /protein_id="BAH48942.1"
FT                   /translation="MTDNIDDIPNDGTVSGGDQNTDVRELADVPSVEVISRAAVMLMSS
FT                   AAEKLGLSDADPDSSPHRDLDEARRVITALAGLVTASIEYLGPHAGPIREGLQALQRAF
FT                   REASSHPDEPGKGPGEKYTGPVY"
     atgacggaca acatcgatga catcccgaac gacggcaccg tgagcggcgg tgaccagaat        60
     accgatgtcc gggaactggc cgacgtgccc tcggtcgagg tcatcagccg cgccgcggtc       120
     atgctcatga gttcggcagc cgagaaactc ggcctgtccg acgccgaccc cgactccagc       180
     ccccaccgcg acctcgacga ggcccgacgg gtcatcacgg cactcgccgg cctggtgacc       240
     gcgtccatcg aatacctcgg accgcacgcc gggccgatcc gcgaaggcct gcaggcgttg       300
     cagcgcgcgt tccgcgaagc gtcttcgcac ccggacgagc ccggcaaggg cccgggtgag       360
     aagtacaccg gaccggtgta ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page