(data stored in ACNUC7421 zone)

EMBL: AP011115.PE696

AP011115.PE696       Location/Qualifiers
FT   CDS_pept        725540..725953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48943"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT11"
FT                   /protein_id="BAH48943.1"
FT                   /translation="MAGRNKTEQTQADVDEFLAAVTDPVKRADSARLVELLTAATGEPA
FT                   AMWGTSIVGFGTRHYRYASGHEGDTALIGFSPRAAALTLYLSLDFTEHETELAALGKHK
FT                   VGKGCLYVKKLADVDESVLVSLMDRSVAAARAL"
     atggcgggcc gtaacaagac cgagcagacg caggcagatg tcgacgagtt cctcgcagcg        60
     gtcaccgacc cggtgaagcg cgccgacagc gcacggctgg tggaactgct caccgccgcg       120
     acgggagagc cggccgcgat gtggggaacg agcatcgtcg gattcggcac ccgccactac       180
     cggtatgcca gcggccacga gggcgacacc gccctgatcg gattctcgcc gcgcgcggcg       240
     gcgctcacgc tgtacctctc tctcgacttc accgagcacg agaccgaact cgcggccctc       300
     ggcaagcaca aggtcggcaa gggctgcctc tacgtcaaga aactcgccga cgtcgacgag       360
     tcggttctcg tctcgctgat ggaccgatcc gtggcggccg cccgcgcgct ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page