(data stored in ACNUC7421 zone)

EMBL: AP011115.PE70

AP011115.PE70        Location/Qualifiers
FT   CDS_pept        complement(60197..61093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00700"
FT                   /product="stomatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48317"
FT                   /db_xref="GOA:C1AS68"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS68"
FT                   /protein_id="BAH48317.1"
FT                   /translation="MILYAVAVIVGLGLLGLSSSIRVVTQFERGVVFRFGRVQPAVRGP
FT                   GLMLLIPIADRLEKVNMQIITMPVPAQDGITRDNVTVRVDAVVYFNVADPVRVAVDVQD
FT                   YVSAIGQVAQTSLRSIIGKSELDDLLSNREGLNQGLELMIDSPALGWGVQIDRVEIKDV
FT                   VLPDSMKRSMSRQAEAERERRARIITADGELQASAKLAQAAETMTEHPAALQLRLLQTV
FT                   VEVAAEKNSTLVLPFPVELLRFLERATPHTAHAPTRTAEPTTTTTPANVNDEPSTRHTQ
FT                   HTPVDARGFALEQSRFG"
     atgattctct atgcggtggc cgtcatagtc ggtctcggcc tactcggcct gagctcgagc        60
     attcgcgtcg tcacacagtt cgaacgcggc gtcgtgtttc ggttcgggcg cgtccagccc       120
     gccgtccgcg gaccgggcct gatgttgctg atcccgatcg ccgaccggct cgagaaggtg       180
     aacatgcaga tcatcacgat gccggtgccc gcccaggacg gcatcacccg cgacaacgtg       240
     accgtccggg tggatgcggt cgtctacttc aacgtcgccg acccggtgcg agtggcagtg       300
     gacgtgcagg actacgtctc cgcgatcggt caggtcgcac agacgtcgct gcggtcgatc       360
     atcggcaaga gcgaactcga cgacctactg tccaacaggg agggcctcaa ccagggcttg       420
     gagctgatga tcgacagccc cgcgctgggg tggggtgtgc agatcgaccg ggtggaaatc       480
     aaggatgtgg tcctccccga ttcgatgaag cggtcgatgt cgcgccaggc cgaggccgaa       540
     cgtgaacggc gggcccgcat catcaccgcc gacggcgaac tgcaagcctc cgcgaaactg       600
     gcccaggccg ccgagaccat gacggaacat cccgcagcgc tgcaactgcg gctcctgcaa       660
     accgtcgtgg aagtcgcggc cgagaagaac tcgaccctcg tgctgccgtt cccggtcgag       720
     ttgctccgct ttctggaacg agcgacaccg cacaccgccc atgctccgac gcgaacagcc       780
     gaacctacaa ccacaaccac tccggccaac gtaaacgacg aaccgtcgac ccggcacaca       840
     caacacacgc ccgtcgacgc ccgcggattc gccctcgaac aatcacgatt cggatag          897
//

If you have problems or comments...

PBIL Back to PBIL home page