(data stored in ACNUC7421 zone)

EMBL: AP011115.PE701

AP011115.PE701       Location/Qualifiers
FT   CDS_pept        731537..732466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48948"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT16"
FT                   /protein_id="BAH48948.1"
FT                   /translation="MLVRRIARPLLSAIFISGGIDALRNPAQKAQAAAPLIDKSTEALP
FT                   GSVTQKIPSDPETLIKINAAVQIGGGVLLATGKAPRLASLALAGSLVPTTVVGHDFWNE
FT                   TDPAKKAAQRTQFLKNVSLLGGLLIAAVDTEGKPSLGWRGRRAARHAQETVAAALPLGS
FT                   GHDHHGPEIAEALAAASERARILSGEAAERGTGLLEVAKDRGTELAKVAADRGAEWAEV
FT                   AKEHGAEWAEVAKEHGAEWADVARERGAELVEAAKEHGPELAEVAREKGGEWAGTAAER
FT                   GEVLGKRARKQAETALEKARAKRDELSH"
     atgctcgtcc gtcgtatcgc tcgcccactg ctgtccgcga tcttcatcag cggagggatc        60
     gatgcacttc gaaatccggc gcagaaagca caggccgccg caccactgat cgacaagtcc       120
     accgaggcgc ttcccgggtc cgtcacgcag aagatcccgt ccgacccgga gacgttgatc       180
     aagatcaacg ccgccgtgca gatcggcggc ggcgtacttc tcgccaccgg taaggcaccg       240
     cgcctcgcgt cgctcgcgct cgcaggcagc ctcgtgccca ctaccgttgt ggggcacgac       300
     ttctggaatg agaccgaccc cgcgaagaag gcggcgcagc gcactcagtt cctcaagaac       360
     gtcagcctgc tcggcggact gctcatcgcc gccgtcgaca ccgagggcaa gccgtcgctg       420
     ggctggcgtg gacgccgcgc cgcccggcac gcacaggaga ccgtggccgc cgccctgccc       480
     ctcggctccg gtcacgatca ccacggcccc gagatcgcag aggccctggc cgcggcgtcc       540
     gagcgggccc gcatcctgtc cggggaggcc gccgagcgcg ggaccggcct cctcgaggtc       600
     gcgaaagacc gtggcaccga actcgcgaag gtcgcggcgg accgcggcgc cgaatgggcg       660
     gaggtcgcga aggagcacgg cgccgaatgg gcggaggtcg cgaaagaaca cggcgccgaa       720
     tgggcggacg tcgcccgcga acgcggcgcg gaactcgtcg aggcggcgaa ggagcacggc       780
     ccggaactgg ccgaggtcgc ccgcgagaag ggcggggaat gggcaggcac cgcagcagaa       840
     cgcggtgagg tgctcggtaa gcgggcccgc aagcaggcgg aaaccgcgct cgagaaggcg       900
     cgggcgaagc gggacgaact gtcccactga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page