(data stored in ACNUC7421 zone)

EMBL: AP011115.PE702

AP011115.PE702       Location/Qualifiers
FT   CDS_pept        732613..734895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48949"
FT                   /db_xref="GOA:C1AT17"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT17"
FT                   /protein_id="BAH48949.1"
FT                   /translation="MPDEDTSRDERELEQQYVTMLYTRLDGLRQYAANRLSRVLLETGG
FT                   TPQARSERESFNQLYTEDLAKYDAAENGLCFGRIDLDGEHRYVGRLGILDEENDYETML
FT                   LDWRAPLARPFYLATPAAPDGVTRRRHIRTRSRRVTAVNDEYLDLAAAEAAGTVTGSDG
FT                   VAGESALLSALNAARTGQMNDIVETIQGEQDAIIRSEHKSVLVVQGGPGTGKTAVALHR
FT                   AAYLLYTYRQQLAKAGVLIIGPNATFLDYIGQVLPSLGETGVLLSTIGDLYPGVRATVE
FT                   DSLDAGEIKGSLDMLDVLKKAVRDRQEVPSRPVELTFDTYRITLDRKVVTRARGRARSS
FT                   RRPHNLARPIFVSSVIEALAQQLADTLGANVVDGGNLLSRDDIADMRDEMREDPAIMTA
FT                   ISALWPELSPQQVLADLYASPKRLADSAPNLTEAQRDSLRRPGMRGFSAADAPLLDELA
FT                   ELLGVDDAAERERARRQWRAQIADAQGALDILTGSAPQDLEDELDPEILMAYDLIDASQ
FT                   LAERHDVGQHQTTAERAAGDRTWTYGHVIVDEAQELSEMAWRMLMRRIPNRWMTLVGDT
FT                   AQTGDPAGTSSWQRILEPYVANRWKLTELTVNYRTPAEIMTSARQVLAEIDPEQTVPRS
FT                   VRESGFAPWALQVSEAELADTVRTCVSRETGPGTTVVIGGHDLVAALADLRSDTVSVLT
FT                   VRDVKGLEFDSVLIAEPQDVLDESPRGMNDLYVALTRATQRLGVVHTKTLPAVLSELGP
FT                   AEVGILS"
     ttgcccgacg aggacacgtc acgcgacgag cgcgagctcg agcagcagta cgtgacgatg        60
     ctctacaccc gactggacgg ccttcgccag tacgcggcga accggctgag ccgtgtactg       120
     ctcgaaaccg gcggcacccc gcaggcgcgg agcgagcgcg agtccttcaa ccagctctac       180
     accgaggacc tcgccaagta cgacgccgcc gagaacggac tgtgcttcgg ccggatcgac       240
     ctcgacggcg agcaccgcta cgtcggccgg ctcggcatcc tcgacgagga gaacgactac       300
     gagacgatgc tcctcgattg gcgtgcgccc cttgcccgcc cgttctatct cgccaccccc       360
     gccgcccccg acggcgtcac ccgccggcgg cacatccgta cgcggagccg ccgggtgacc       420
     gccgtcaacg acgaatacct ggacctggcg gccgcggagg ccgcgggcac ggtcaccggt       480
     tcggacggcg tcgcgggtga gagcgcgctg ctctccgcgt tgaacgcggc ccgcaccggt       540
     cagatgaacg acatcgtcga gacgatccag ggcgagcagg acgccatcat ccggtcggag       600
     cacaagagcg tgctcgtggt gcagggcggt cccggaaccg ggaagaccgc ggtcgccctg       660
     caccgcgccg cctacctgct gtacacgtat cgccagcagc ttgcgaaggc cggcgtcctc       720
     atcatcggcc ccaacgccac gttcctcgac tacatcggcc aggtgctgcc gtcgctcggc       780
     gagaccggtg tgctgctctc caccatcggt gacctctacc ccggcgtccg ggccaccgtc       840
     gaggacagcc tcgacgcagg cgagatcaag ggctcgctcg acatgctgga cgttctcaag       900
     aaggcggtcc gggaccggca ggaagtgccg tcgcggcccg tcgagctcac gttcgacacc       960
     taccggatca ccctcgaccg caaggtcgtc acccgcgctc gcggccgggc gaggtcgtcc      1020
     aggcgcccgc acaacctggc ccgtccgatc ttcgtctcct cggtcatcga ggcgctcgcg      1080
     cagcaactcg cggacaccct cggcgccaac gtcgtcgacg gcgggaacct gctgagccgg      1140
     gacgacatcg ccgacatgcg cgacgagatg cgtgaggacc cggcgatcat gacggcgatc      1200
     agcgcgctgt ggccggaatt gtcgccgcag caggtcctcg ccgatctgta cgcctcaccg      1260
     aagcggcttg ccgattccgc cccgaatctg accgaagcgc aacgtgactc gctgcgccgc      1320
     cccggaatgc gcggcttcag cgccgccgac gccccactcc tcgacgaact ggccgaactc      1380
     ctcggcgtcg acgacgccgc cgaacgggag cgcgcccgtc gccagtggcg ggcacagatc      1440
     gcggacgccc agggcgccct ggacatcctg accggttcgg caccgcagga cctcgaggac      1500
     gaactggacc cggaaatcct gatggcctac gacctgatcg acgccagcca gctcgccgaa      1560
     cgccacgacg tcgggcagca ccagaccacc gcggaacgcg ccgccggcga ccgaacgtgg      1620
     acctacggtc acgtgatcgt cgacgaggcg caggaactct ccgagatggc ctggcgaatg      1680
     ctgatgcggc gcataccgaa tcgctggatg acgctggtcg gcgacaccgc gcagaccggc      1740
     gacccggcgg gaacgtcgtc gtggcagcgg atcctcgaac cgtatgtcgc caaccggtgg      1800
     aagctgacgg aactgaccgt caactaccgc acaccggcgg agatcatgac gtcggcccgg      1860
     caggttctcg ccgagatcga tccggagcag accgtgccgc ggtcggtgcg cgaatccggc      1920
     ttcgcgccgt gggccctgca ggtgtcggag gccgaactgg cagacaccgt gcgcacctgc      1980
     gtgtcccggg aaaccggacc gggcaccacc gtcgtgatcg gcggccacga tctcgtcgcg      2040
     gcactcgccg acctgcggtc ggacaccgtc agcgtcctca cggtgcgaga cgtcaaggga      2100
     ttggaattcg actcggtgct catcgccgag ccccaggacg ttctcgacga atcgccgcgg      2160
     ggaatgaacg acctctacgt cgccctgacc cgtgcgacgc aacgcctcgg tgtggtgcac      2220
     acgaagacgt tgcccgcagt gctgtccgaa ctcggcccgg cagaggtcgg gatcctgtcc      2280
     tga                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page