(data stored in ACNUC7421 zone)

EMBL: AP011115.PE703

AP011115.PE703       Location/Qualifiers
FT   CDS_pept        complement(735007..735459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07030"
FT                   /product="putative Usp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48950"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT18"
FT                   /protein_id="BAH48950.1"
FT                   /translation="MSAYRTVVVGTDGSESSFLAVEKAAAIAGDAGAKLIIACAYYPAD
FT                   PKDVGSAADALGDEAYQITGSAPTYEILRTAKERAHAAGAKEVVERAVVGAPVESLLNL
FT                   VDEVEAGLLVIGNRGLNTLTGRLLGSVPSDAARKSTSDVLIVHTVR"
     atgagcgcct accggaccgt tgtcgtcgga accgatggct ccgagtcgtc gtttctggcc        60
     gtcgagaagg ctgccgccat cgcgggggac gccggtgcca agctgatcat cgcctgcgcg       120
     tactacccgg ccgatcccaa ggacgtcgga tcggcggccg acgcgctcgg tgacgaggcc       180
     taccagatca ccggttcggc gccgacgtat gagatcctgc gcaccgcgaa ggagcgtgcc       240
     cacgccgccg gcgccaagga ggtcgtcgaa cgcgctgtcg tcggcgcccc cgtcgagtcg       300
     ctgctgaacc tggtcgacga ggtcgaggcc ggtctcctcg tgatcggcaa ccgtggactc       360
     aacaccctca ctgggcggct cctgggctcc gttccgtccg atgctgcgcg caagtccacg       420
     tccgacgtcc tcatcgttca cacggtgcgc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page