(data stored in ACNUC7421 zone)

EMBL: AP011115.PE704

AP011115.PE704       Location/Qualifiers
FT   CDS_pept        complement(735647..736519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48951"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT19"
FT                   /protein_id="BAH48951.1"
FT                   /translation="MDAHNAGRTARSLELLHSLSYFVPEVEDRLVEAGLEPGRMSYFAG
FT                   RSAPMGAVGAGVVTATFFNFSPAAVASIIPRAWGLATPAAIVEARYRAVGEAYVRLLGE
FT                   SVTTSPEMAEAAELASIAARGIPGVEGRPLCAGYTEVEWPDSPHLAFWHALTVLREYRG
FT                   DGHIAALQTAGLSGLESLITHTATGYGFQKKFAITRRAWTQDQWDSACDSLRDREILDA
FT                   RGELTAEGKELRELVEDLTDDLALAPWAALGEDGAARLVELATPWRDAVVAAGVFPAGV
FT                   FGPKVPVSR"
     atggatgcac acaacgcagg tcgcaccgcc cggtccctgg aattgcttca ttcgctcagc        60
     tacttcgttc ccgaggtcga ggatcggctg gtcgaggcgg ggctcgaacc gggccggatg       120
     agctacttcg ccggacgttc cgcgccgatg ggtgcggtcg gcgcgggcgt tgtcacggca       180
     acgttcttca acttcagtcc cgccgcagtc gcgtcgatca ttccgcgtgc ctggggcctg       240
     gccacgcccg cggcgatcgt cgaggcccgg taccgcgcgg tcggcgaggc gtacgtgcga       300
     ctgctcggtg aatcggtgac gacgtcgccg gagatggccg aggcggccga actggcgtcg       360
     atcgcggcgc gggggattcc cggtgtcgaa ggcaggccgc tctgcgcggg ctacacggaa       420
     gtggagtggc cggactcacc gcacctcgcg ttctggcacg ccctcaccgt gctgcgggag       480
     taccgcggcg acggtcacat cgccgccctg cagacggcgg gcctcagcgg actcgaatcg       540
     ctgatcaccc acaccgcgac cgggtacggg ttccagaaga agttcgcgat cacccgccgc       600
     gcctggacgc aggatcagtg ggactccgca tgcgacagtc tgcgcgaccg ggagatcctg       660
     gacgcccggg gtgaactcac cgccgaaggc aaggaactgc gggaactggt cgaggatctc       720
     accgacgatc tcgcgctggc gccgtgggcg gcactggggg aggacggtgc ggcccggctc       780
     gtcgaactcg cgaccccgtg gcgcgacgcg gtcgtcgcgg cgggcgtgtt cccggccggc       840
     gtcttcggtc ccaaagtccc cgtgtcccgc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page