(data stored in ACNUC7421 zone)

EMBL: AP011115.PE706

AP011115.PE706       Location/Qualifiers
FT   CDS_pept        738791..739309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48953"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR014465"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT21"
FT                   /protein_id="BAH48953.1"
FT                   /translation="MAGASTDIHPPKVEYFDLRDHTNTDPKGFVRHVDHYRVEPWGLYM
FT                   ARTADHRQFHYLESWLLPDLGLRASIFHYHPYHQRDQDHYVDVGTFTRGENVWKSEDHY
FT                   LDLVIRTGRDTELLDVDELMEAHRTGLLDAATAEQAILTATTAIDGIAAHGHDLGGWLA
FT                   SIGMPIDWR"
     atggcaggcg cgagcaccga catccaccca ccgaaggtcg aatacttcga cctccgcgat        60
     cacaccaaca ccgaccccaa gggtttcgtc cgtcacgtcg accactaccg cgtcgagccg       120
     tgggggctgt acatggcacg caccgcggac caccggcagt tccactacct ggagtcgtgg       180
     ttgcttcccg acctggggct gcgcgcgtcg atcttccact accacccgta ccaccagcgc       240
     gatcaggacc actacgtcga cgtcggcacc ttcacccggg gcgagaacgt gtggaagtcg       300
     gaggatcact acctggatct ggtcatccgc accggccggg acaccgaact cctcgacgtc       360
     gacgaactga tggaggcgca ccgcaccggc ctgctcgacg ccgcgacggc cgagcaggcg       420
     atcctcaccg ccaccacggc gatcgacgga atcgccgcac acggccacga cctcggcgga       480
     tggctggcct cgatcggcat gccgatcgac tggcggtga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page