(data stored in ACNUC7421 zone)

EMBL: AP011115.PE708

AP011115.PE708       Location/Qualifiers
FT   CDS_pept        740694..740912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48955"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT23"
FT                   /protein_id="BAH48955.1"
FT                   /translation="MRDHRNQFGRHRLGMAGGVHCIEIPEVASALAEHRRTWLTALISQ
FT                   GRHSFATMRKRTEVQSSSGYWIPATAN"
     atgcgcgatc accgcaacca gttcggtcgg caccgcctcg gcatggcagg cggggtgcat        60
     tgcatcgaga ttcccgaggt agcctccgcg ctcgccgagc atcgccggac ctggctcacc       120
     gccctcatca gccagggcag gcacagcttc gcgacgatgc gcaagcgcac cgaggtgcag       180
     tcctcgtccg gctactggat tcccgcaacc gcgaactga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page