(data stored in ACNUC7421 zone)

EMBL: AP011115.PE711

AP011115.PE711       Location/Qualifiers
FT   CDS_pept        complement(743733..744494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07110"
FT                   /product="putative amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48958"
FT                   /db_xref="GOA:C1AT26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT26"
FT                   /protein_id="BAH48958.1"
FT                   /translation="MTPMVKADRVCKNFGALKVLKGVSLEIGAGQVLCLVGPSGSGKST
FT                   FLRCINHLEQVNAGRLYVDGEIVGYSERGGKLYELHPRAAAKQRRDIGMVFQHFNLFPH
FT                   RTALENIIEAPIQVKKLSKKKALERARDLLDQVGLSEKADAYPAQLSGGQQQRVAIARA
FT                   LAMDPKLMLFDEPTSALDPELVGEVLTVMKDLAAGGMTMVVVTHEMGFAREVADQLVFM
FT                   DAGVVVESGNPRELLANPQHDRTKAFLSKLL"
     atgacgccga tggtcaaggc ggaccgggtc tgcaagaact tcggggcgct gaaagtactc        60
     aaaggtgtct ccctggagat cggcgccggc caggtcctgt gcctggtcgg tccgtccggc       120
     tccgggaagt cgacgttcct gcggtgcatc aatcacctcg agcaggtcaa cgccggccgg       180
     ctgtacgtcg acggcgagat cgtcgggtac tccgagcggg gcggcaagct ctacgaactc       240
     cacccccggg cggcggcgaa acagcgccgc gacatcggga tggtcttcca gcacttcaac       300
     ctcttcccgc accggacggc cctcgagaac atcatcgagg cacccatcca ggtgaagaag       360
     ctgagcaaga agaaggcgct cgaacgggcc cgggatctcc tcgaccaggt gggcctgagc       420
     gagaaggcgg acgcgtatcc cgcgcaactg tcgggcggac agcagcagcg cgtcgccatc       480
     gcccgcgcgc tggcgatgga tcccaagctg atgctgttcg acgagccgac gtccgccctc       540
     gacccggagt tggtggggga ggtgctcacc gtgatgaagg atctcgcggc aggcggcatg       600
     accatggtcg tcgtcaccca cgagatgggc tttgcccgcg aggtggccga ccagttggtg       660
     ttcatggacg cgggcgtcgt cgtcgagtcc ggtaatcccc gggaattgct ggccaatccc       720
     cagcacgacc gcaccaaggc gttcctgtcg aagctgctgt ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page