(data stored in ACNUC7421 zone)

EMBL: AP011115.PE712

AP011115.PE712       Location/Qualifiers
FT   CDS_pept        complement(744491..745474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07120"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48959"
FT                   /db_xref="GOA:C1AT27"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT27"
FT                   /protein_id="BAH48959.1"
FT                   /translation="MEKAPDRPGTETGQEPEPIKAIPLRRPGRWIAAIVVGLLLALFVN
FT                   GARTNEAYRWDVYAQYLFDARISAAAWNTIQLTILSMAIAIVLGVVLAVMRLSPNPVLK
FT                   AASWGYLWIFRGTPVYVQLVFWGLFPSIYKQLDLGIPFVHQFVHIDLQGINAAFLFAVI
FT                   GLGLNEAAYMAEIVRAGVNSVAEGQSEASVALGMTWSQTMRRTVLPQAMRVIIPPTGNE
FT                   LISMLKTTSLVTAVPYSLELYGRARDISGANFQPIPLLMVAATWYLAITSLLMIGQFYL
FT                   ERYYSKGASRKLTPRQLQALADAQGKPLVIEPGPETLPDTPGGERR"
     gtggagaagg ctccggaccg gccgggcacc gagacggggc aggaaccgga acccatcaag        60
     gcgatcccgc tgcggcggcc gggccggtgg atcgccgcga tcgtcgtcgg cctgctgctg       120
     gcgctgttcg tcaacggtgc gcgcaccaac gaggcgtacc ggtgggacgt ctacgcccag       180
     tatctgttcg acgcccggat ttcggccgcc gcatggaaca ccatccagct gacgatcctg       240
     tcgatggcca tcgccatcgt gctcggcgtc gtgctcgccg tcatgcggct gtcgccgaac       300
     ccggtgctga aggcggcgtc gtgggggtac ctgtggatct tccgcggcac cccggtctac       360
     gtgcagttgg tgttctgggg actgttcccg tcgatctaca agcaactgga tctgggaatc       420
     cccttcgtcc accagttcgt gcacatcgac ctgcagggaa tcaacgcggc attcctgttc       480
     gcggtgatcg gcctgggact caacgaggcc gcgtacatgg ccgagatcgt ccgcgccggc       540
     gtgaactcgg tcgccgaggg gcagtccgag gcgtcggtgg cgctcggcat gacgtggtcg       600
     cagaccatgc gtcgcacggt tctgccgcag gccatgcggg tgatcatccc gcccaccggc       660
     aacgagctga tcagcatgct gaagacgacg tcgctggtca cggcggtgcc gtacagcctg       720
     gagttgtacg gacgtgccag agacatctcg ggcgcgaact tccagcccat cccgctgctg       780
     atggtggccg ccacctggta cctcgccatc accagtctgc tcatgatcgg ccagttctac       840
     ctggagcggt attactcgaa gggggcgtcc cgcaagctca cgccgcggca actgcaggcg       900
     ctcgccgacg cgcagggcaa gccgctggtg atcgaacccg gccccgagac cctgcccgac       960
     acacccggag gggaacgacg atga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page