(data stored in ACNUC7421 zone)

EMBL: AP011115.PE713

AP011115.PE713       Location/Qualifiers
FT   CDS_pept        complement(745495..746424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07130"
FT                   /product="putative amino acid ABC transporter amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48960"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT28"
FT                   /protein_id="BAH48960.1"
FT                   /translation="MPVSGRSVFARGRVARTICALAGGSALLLAGCASNTEGGGSPSGE
FT                   DTVAVEVDKVDAIAATLPEKIASSGKIIVGVNIPYSPNEFKDPSGKIVGFDVDLVDAVG
FT                   KVLGVTPEYTEADFDKIIPSIQAGSYDMGMSSFTDTKEREQSVDFTTYFSAGVQWAQPA
FT                   GKSVDPTNACGLRVGVQTTTIEDLEEVPAKSAACVAAGKPPIEIVKFDSQDDAANAVAL
FT                   GKVDAMSADSPVTAYAIKQSDGKIEAAGEVFDAAPYGWPVAKGSPLAQTLQQALQHLID
FT                   DGTYRTIAENWGVEAGVITTSQINGATS"
     atgccagtgt ctggtcgatc cgtcttcgcg cgaggccgag tggcccgcac catctgtgcg        60
     ctggcgggtg gcagtgctct gctgctcgcc ggctgtgcca gcaacaccga gggcggcggc       120
     tcgccgtccg gagaagacac cgtcgccgtg gaagtcgaca aggtggatgc catcgcggcg       180
     acactgccgg agaagatcgc ctcgtccggc aagatcatcg tcggcgtgaa cattccctac       240
     tcgcccaacg agttcaagga cccgagcggc aagatcgtcg gcttcgacgt cgacctcgtg       300
     gacgccgtgg gcaaggtcct cggcgtgaca ccggagtaca cggaagcgga cttcgacaag       360
     atcatcccgt cgatccaggc cggcagctac gacatgggta tgtcgtcgtt caccgacacc       420
     aaggaacgcg agcagtcggt cgacttcacc acatacttca gcgccggagt gcagtgggcg       480
     cagcccgccg ggaagtccgt cgaccccacc aacgcgtgcg gcctgcgggt gggcgtgcag       540
     accaccacca tcgaggacct cgaggaggtg cccgccaaga gtgcggcgtg cgtcgccgcc       600
     ggtaagccgc ccatcgagat cgtgaagttc gacagccagg acgacgccgc caacgccgtc       660
     gccctcggca aggtcgacgc gatgtccgcc gactcgcccg tcaccgcgta cgcgatcaag       720
     cagagtgacg gcaagatcga ggccgcgggc gaggtcttcg acgccgcgcc gtacggctgg       780
     cccgtcgcga agggctcgcc gctcgcgcag accctccagc aggcgctgca acacctcatc       840
     gacgacggca cctaccggac gatcgcggag aactggggag tcgaggcggg cgtcatcacc       900
     acgtcccaga tcaacggcgc cacgagctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page