(data stored in ACNUC7421 zone)

EMBL: AP011115.PE715

AP011115.PE715       Location/Qualifiers
FT   CDS_pept        747688..748209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48962"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT30"
FT                   /protein_id="BAH48962.1"
FT                   /translation="MVQSVELLFDEATDVAVRAEWQRLWDAGMPSRTRVRAESNRPHIT
FT                   LFVARHIPPEIDELLGRRIATPSFHVRLGGLVMFGGRHVTLSRLVVPSKALLSLHRSVF
FT                   DLAEHATEVTPHIRPGEWTPHVTLARRLPADQIPEAARLLDGGDIVGRASVVRRWDGDA
FT                   KREWVVTAPP"
     atggtccagt cggtggaact gctgttcgac gaagcgaccg acgttgccgt gcgcgccgag        60
     tggcaacgcc tgtgggatgc ggggatgccc agccgcaccc gggttcgcgc cgaatcgaat       120
     cggccccaca tcaccctgtt cgtggcacgc cacatccctc ccgagatcga cgaactgctg       180
     ggccgccgga tcgcgacgcc ctcgttccac gtccggctgg gcgggctcgt gatgttcggc       240
     ggcaggcacg tcacgctgtc ccggctggtg gtgccgtcga aggccctgct gtctctgcac       300
     cgcagcgtgt tcgatctcgc cgagcacgcc acggaggtca ctccgcacat ccgcccgggc       360
     gagtggacgc cccacgtgac cctcgcgcgg cgactgcccg cggatcagat cccggaggcc       420
     gcgcggttgc tcgacggcgg cgacatcgtc ggccgggcct cggtggtgcg gcgatgggac       480
     ggggacgcca aacgcgagtg ggtggtcacg gcacctccgt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page