(data stored in ACNUC7421 zone)

EMBL: AP011115.PE716

AP011115.PE716       Location/Qualifiers
FT   CDS_pept        complement(748210..749115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07160"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48963"
FT                   /db_xref="GOA:C1AT31"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT31"
FT                   /protein_id="BAH48963.1"
FT                   /translation="MRGNPAVQYAGTALAWGASFLFIKVGLEGLSFTQVVLWRLVFGAV
FT                   TLGAVLGITRTRLPRAAATWAHLSVLAVAQCLLPWLLFSWAEQSISSGLASIYNATTPL
FT                   MTMSVALAFLPGEKLTDAKLFGLLLGFGGVVVVLAPWQSGILGSVPAQLACLGATASYG
FT                   VALVYLRRFVLPRGVSTPTIAFMQVSIAAAAMVLATPWAASTPMHLTPAIVASMIGLGA
FT                   FGTGLAFVWNTNVVRGWGPTAASTVTYLTPVVGVALGAVALDERISWNQPVGALAVIAG
FT                   IVVTQRSSRKAAATTAAHTP"
     ttgaggggta atccggcggt ccagtacgcg ggcacggcgc tcgcctgggg cgcgagtttc        60
     ctgttcatca aggtcggcct cgagggcctg tccttcaccc aggtcgtgct gtggcgactg       120
     gtgttcgggg cggtgaccct cggcgccgtc ctcggaatca cccggacgcg gctgccgcgc       180
     gcagcggcga cctgggcgca cctgtcggtg ctggccgtcg cgcagtgcct gcttccgtgg       240
     ctgctgttca gctgggccga gcagagcatc agttcgggcc tggccagcat ctacaacgcc       300
     accacaccgc tgatgacgat gtcggtggcc ctggcgttcc tgccggggga gaagctcacg       360
     gacgcaaagc tgttcggtct cctgctcgga ttcggcggtg tggtcgtcgt gctggcgccg       420
     tggcagtcgg ggattctcgg cagcgtgccc gcccaactcg cgtgcctcgg cgccaccgcg       480
     tcctacggcg tggcactggt ctacctgagg cggttcgtcc tcccgcgcgg ggtgagtacg       540
     ccgaccatcg cgttcatgca ggtgtcgatc gccgcggctg ccatggtgct cgccacaccg       600
     tgggccgcga gcacgccgat gcacctgacc cccgcgatcg tcgcgtcgat gatcgggctc       660
     ggggcgttcg gcacgggact ggcgttcgtg tggaacacga acgtggtgcg aggctggggg       720
     cccaccgcgg cgtccaccgt tacctacctg accccggtgg tcggcgtcgc actcggcgcg       780
     gtcgcactcg acgagcgcat ctcgtggaac cagccggtcg gggcgctcgc ggtgatcgcg       840
     ggaatcgtcg tcacccaacg gtcctcgcgc aaggccgccg cgacgaccgc cgcgcacaca       900
     ccgtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page