(data stored in ACNUC7421 zone)

EMBL: AP011115.PE72

AP011115.PE72        Location/Qualifiers
FT   CDS_pept        complement(63621..65201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48319"
FT                   /db_xref="GOA:C1AS70"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS70"
FT                   /protein_id="BAH48319.1"
FT                   /translation="MIRWLVIAGAWVLGVASLLLIFLVSSWWLLVTVIAAAIAMVGTWD
FT                   LLQRRHSVLRNYPVIGHARFLLERIRPEIQQYFIERSTDGTPFDRDTRTTVYERAKGTK
FT                   DVEPFGTERDVTATGYEFVTHSLRAHTASDDTPHVRIGGPQCTMGYDIALYNVSAMSFG
FT                   SLSGNAIEALNGGAARGGFAHDTGEGGISPYHLAHGGDLIWEIGSGYFGCRDPDGHFDP
FT                   GEFAAKAALPQVKCISIKLSQGAKPGLGGVLPAAKVSPEIARTRGVPVGQTVISPPSHS
FT                   AFCTPLELIDFITTLRALSGGKPIGFKLCVGSRTEFLAICKAMLETGITPDFIIVDGSE
FT                   GGTGAAPLEFEDHVGMPLTEGLMLVHNALVGTGLRDRIKIGASGKVANGIDIIKRLIQG
FT                   ADFTLAARAMMFAVGCIQAQRCHTNRCPVGVTTQDARRARALHVPDKTTRVYNLQRSTV
FT                   ASAQQILASMGLDDFCDLDPSMLNRRIQGHRTMTYADLHEWLQPGDLLTEDPPTSWLRD
FT                   WTNADSSRF"
     atgatccgtt ggctggtcat cgcgggcgcc tgggtgctgg gggtggcgtc gctgctgctg        60
     atcttcctcg tgtcgagctg gtggctgctc gtcacggtga tcgcggcggc gatcgcgatg       120
     gtcggcacct gggacctgct gcagcgcagg cacagtgtgc tgcggaacta tccggtgatc       180
     ggccacgccc ggttcctgct cgagcggata cgccccgaga tccagcaata cttcatcgaa       240
     cgatccacgg acggaacacc gttcgaccgc gacacccgca ccacggtgta cgaacgcgcc       300
     aagggcacca aggacgtgga acccttcgga accgaacggg acgtcaccgc caccggatac       360
     gagttcgtca cccactcgtt gcgcgcgcat accgcctccg atgacacacc acatgtccgg       420
     atcggcggtc cgcagtgcac catggggtac gacatcgcct tgtacaacgt ctcggcgatg       480
     agcttcggat ccctgtcggg caacgccatc gaggcgctca acgggggcgc ggcccgcggc       540
     gggttcgccc acgacaccgg cgagggcggt atcagtcctt accacctcgc gcatggcggc       600
     gacctgatct gggagatcgg atccggctac ttcggctgcc gcgaccccga tgggcacttc       660
     gatcccggcg agttcgccgc caaggccgcc ctgcctcagg tgaaatgcat ctccatcaag       720
     ctctcccagg gggcgaaacc cgggctcggg ggagtgctcc ccgccgcgaa agtcagcccc       780
     gagatcgccc gaacccgagg ggtgccggtc gggcagaccg tgatctcgcc gccatcccac       840
     agcgccttct gcaccccgct cgagctcatc gacttcatca ccacacttcg tgcattgtcc       900
     ggcggaaaac ccatcggctt caaactctgc gtcggttccc gcacggaatt cctcgccatc       960
     tgcaaggcca tgctcgagac cggcatcacc ccggacttca tcatcgtcga cggctccgag      1020
     ggcggaaccg gggctgcccc gctcgaattc gaggaccacg tcgggatgcc gctcaccgag      1080
     ggcctgatgc tggtgcacaa cgcgctggtg ggcaccgggc tgcgggaccg gatcaagatc      1140
     ggcgcctccg gcaaggtcgc caacggaatc gacatcatca aacgcctgat ccagggagcg      1200
     gacttcaccc tcgccgcccg cgcgatgatg ttcgcggtcg gctgcatcca ggcccaacgc      1260
     tgccacacca accggtgccc cgtcggtgtc accacccaag acgcccgccg ggcccgcgca      1320
     ctccacgtgc cggacaagac gacccgggta tacaacctcc agagatccac cgtcgcgagc      1380
     gcccaacaaa tcctggcatc gatggggctg gacgacttct gcgacctcga tccgtcgatg      1440
     ctcaaccggc gcatccaggg gcaccgcacg atgacctacg cggacctaca cgagtggctg      1500
     cagcccggtg acctgctcac ggaggacccc ccgacgagtt ggctccgcga ctggacgaac      1560
     gccgactcgt caaggttttg a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page