(data stored in ACNUC7421 zone)

EMBL: AP011115.PE720

AP011115.PE720       Location/Qualifiers
FT   CDS_pept        753705..755105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07200"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48967"
FT                   /db_xref="GOA:C1AT35"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT35"
FT                   /protein_id="BAH48967.1"
FT                   /translation="MAPTVRKRLPAVRTRPTSARKHTRRGPVTRQLGRAFVLVLLGLVA
FT                   AIAFGGPAAAQEPTPPPPPSTSVQPAPPANAVRVSGNLNNAGERLADVEVRALDSSGTE
FT                   VAKATSESNGRWELQVAPGTYTFEIVADSLPDDVSVQGTVEREVVAGRANTVIFSFGEA
FT                   RTGSAVPFYEKLIRQTIDGLRFGLVIAIAGVGLSLIYGTTGLTNFAHGELVTLGAVAAW
FT                   VINVTFGVQLIPATVLAVFVGILIGLLNNAAIWKPLRKRKTGLIAQLVVSIGLAISLRY
FT                   LILIFFSDRAEPFVDYQAQVERHWGPIAITDANLVCIGISLVVLVGVALLLQKTRIGKA
FT                   MRAVSDNRDLAASSGIDVERVIRFVWGLGGGLAALGGVLFGISELGGRVQWEMGFKLLL
FT                   LMFAGITLGGLGTAYGALLGCVIVGLLVQLSTLVINPDLKYIGGLLILIVILVVRPQGI
FT                   LGSRQRIG"
     gtggccccaa ccgtgaggaa gcgactccca gcagtgagga cgcgaccgac atccgcgagg        60
     aaacacacga ggcgaggtcc ggtcacccgg caactcggcc gtgcgttcgt cctcgtcctg       120
     ctcggcctcg tcgcggcgat cgccttcggc ggtcccgcgg cggcgcagga gcccacgccg       180
     ccgcccccgc cctcgaccag tgtgcaaccg gcgccgcccg cgaacgcggt gcgggtcagc       240
     ggcaatctca acaacgccgg cgaacggctc gcggacgtcg aggtgcgcgc cctcgactcg       300
     tcgggcaccg aggtcgcgaa ggcgacgtcg gagtcgaacg gtcgctggga actccaggtc       360
     gcgcccggca cgtacacgtt cgagatcgtc gcggactccc tgcccgacga cgtcagcgtg       420
     cagggcacgg tggagcgtga ggtggtggcc ggtcgcgcca acacggtgat cttctcgttc       480
     ggcgaggctc ggaccggttc cgcggtcccg ttctacgaga agctgattcg ccagaccatc       540
     gacggactcc ggttcggact cgtcatcgcc atcgccggtg tcgggctgag cttgatctat       600
     ggcaccaccg gcctgacgaa cttcgcgcac ggcgaactcg tcaccctcgg cgcggtcgcg       660
     gcgtgggtga tcaacgtgac gttcggcgtg cagctgatcc cggcgaccgt cctcgccgtg       720
     ttcgtgggga tcctgatcgg cctgctgaac aacgccgcga tctggaaacc gctgcgcaaa       780
     cgcaagaccg gtctgatcgc ccagctggtg gtgtcgatcg gactcgcgat ctccctgcgc       840
     tacctgatcc tgatcttctt ctccgatcgc gcggaaccgt tcgtcgacta ccaggcgcag       900
     gtggagcggc actggggtcc gatcgcgatc accgacgcca acctcgtgtg catcggcatc       960
     agcctcgtcg tcctcgtcgg agtggccctg ctgctgcaga agacgcgcat cggcaaggcc      1020
     atgcgcgccg tgtccgacaa ccgcgacctg gccgcgtcct ccggcatcga cgtcgaacgg      1080
     gtgatccgct tcgtgtgggg gctcggcggc ggcctggccg cactcggcgg cgtcctgttc      1140
     ggcatctccg aactcggcgg ccgcgtccag tgggagatgg gtttcaaact tctgctgctg      1200
     atgttcgccg gcatcacgct cggcggactc ggcaccgcct acggcgcgct gctcggctgt      1260
     gtgatcgtcg gtctgctcgt ccagctgtcg acgctggtga tcaaccccga cctcaagtac      1320
     atcggaggac tgctcatctt gatcgtcatc ctggtggtcc ggcctcaggg cattctcggc      1380
     agccggcaaa ggatcgggtg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page