(data stored in ACNUC7421 zone)

EMBL: AP011115.PE721

AP011115.PE721       Location/Qualifiers
FT   CDS_pept        755110..756099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07210"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48968"
FT                   /db_xref="GOA:C1AT36"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT36"
FT                   /protein_id="BAH48968.1"
FT                   /translation="MDITGALQVSLAQLIGPSAIFYALLAIGLNLHFGYAGLLNFGQIG
FT                   FALLGGYGVGIMTVTYQQPLWVGILVGLAAAGLLAVVLGIPTLRLRADYLAIVTIAASE
FT                   ILRLIFRSTASDSITGSTNGLFGFADPFTTLSPFDSGKQYNFLGVKFYGDDLWSMVVGW
FT                   TLVLVLCGFVYLLTHSPWGRVLKAVREDEDAARALGKNVFVYKMQALVLGGMIGGLGGV
FT                   FNALQTKSINPDFYSTAQTFFAFGALILGGAATVFGPVVGAMLFWFLLAIPDALLRQAI
FT                   SGPEPLLPLTEQQVGAMRFVLLGIMIAVLMIFRPQGILGNKREVQLNA"
     atggacatca caggagcact ccaggtctcg ctcgcccagc tgatcggccc gtccgcgatc        60
     ttctacgcgc tgctggcgat cggcctcaac ctgcacttcg gctacgccgg gctgctgaac       120
     ttcggccaga tcggtttcgc actcctcggt ggctacggcg tcgggatcat gaccgtcacc       180
     taccagcagc cgctgtgggt cggcatcctc gtcggtctcg ccgccgccgg gttgctcgcc       240
     gtcgtcctcg gcatcccgac gctgcgattg cgggccgact acctcgccat cgtcacgatc       300
     gccgcgtccg agatcctgcg gctgatcttc cgctccaccg cttcggattc catcaccgga       360
     tccaccaacg gcctgttcgg cttcgccgat ccgttcacca cgctcagccc gttcgactcg       420
     ggtaagcagt acaacttcct cggcgtgaag ttctacggcg acgacctgtg gtcgatggtc       480
     gtcggctgga ctctcgtcct ggtgctgtgc gggttcgtct acctcctcac gcacagcccg       540
     tggggccgcg tcctcaaggc ggtgcgcgaa gacgaggacg ccgcccgcgc cctcggcaag       600
     aacgtcttcg tctacaagat gcaggcgctg gtcctcggcg gcatgatcgg cgggctcggc       660
     ggcgtgttca acgcattgca gaccaagtcg atcaaccccg acttctactc caccgcccag       720
     acgttcttcg cgttcggcgc cctcatcctc ggcggcgcgg ccaccgtctt cggaccggtg       780
     gtcggcgcga tgctgttctg gttcctgctg gccatcccgg acgcgttgct gcgacaggcc       840
     atttccgggc cggaaccgct gctgccgctg acggaacagc aggtcggcgc gatgcggttc       900
     gtcctgctcg gcatcatgat cgcggtgctg atgatcttcc ggccgcaggg catactgggc       960
     aacaagcggg aggtgcagct caatgcctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page