(data stored in ACNUC7421 zone)

EMBL: AP011115.PE722

AP011115.PE722       Location/Qualifiers
FT   CDS_pept        756092..757111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07220"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48969"
FT                   /db_xref="GOA:C1AT37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT37"
FT                   /protein_id="BAH48969.1"
FT                   /translation="MPDHRLPDHLQTDTVLTAEERASIFTDVPHSPGAAKPDPILLVDN
FT                   VSRTFGGLRAVDVAHLEIQRGCITGLIGPNGAGKTTLFNLLTGFDRPDSGTWSMDGQSL
FT                   GRMYPHQVARRGVVRTFQLTKALSKLTVLDNVRLGATGQRGERIFNTLLPWTWKAQERA
FT                   VTERANELLARFKLDTKSDDLAGSLSGGQRKLLEMARALMTEPTVVMLDEPMAGVNPAL
FT                   TQSLLGHIKSLRDEGMTVVFVEHDMDVIRDISDWVVVMAQGSVIAESTPEHLSSNSAVV
FT                   DAYLGSHHDQALEFDDEGNPVGATAVLAEALESAEAETLETGGDLSEPDITELRRENP"
     atgcctgacc acagactgcc ggatcatctg cagaccgaca ccgtgctcac cgccgaggaa        60
     cgggcctcga tcttcaccga cgtcccgcac tcccccggcg cggccaagcc cgacccgatc       120
     ctcctcgtcg acaacgtgtc ccggacgttc ggcgggctca gggccgtcga cgtggcgcat       180
     ctggagatcc agcgcggctg catcaccgga ctgatcggtc cgaacggcgc gggcaagacg       240
     accctgttca acctgctcac cggtttcgac cggccggaca gcggcacgtg gtcgatggac       300
     ggccagtccc tcggccggat gtatccgcac caggtggccc gccgcggcgt cgtccggacg       360
     ttccagctca ccaaggcgct gtcgaagctg acggtgctcg acaacgtgcg gctcggcgcc       420
     accgggcaac gcggcgagcg gatcttcaac accctgctgc cgtggacgtg gaaggcgcag       480
     gaacgcgccg tcaccgaacg ggccaacgaa ctgctcgcgc ggttcaaact cgacaccaag       540
     tccgacgacc tcgcgggctc gctgtccggc ggtcagcgca agctgctcga gatggcgcgg       600
     gcgctgatga ccgagccgac cgtggtgatg ctcgacgagc cgatggccgg agtgaacccg       660
     gcgctcaccc agagtttgct gggccacatc aaatcgcttc gggacgaggg catgacggtc       720
     gtgttcgtcg aacacgacat ggacgtcatc cgcgacatca gcgactgggt ggtggtgatg       780
     gcgcagggca gtgtgatcgc cgagtccacc ccggaacacc tctcgtcgaa cagcgcggtc       840
     gtcgacgcgt atctcggcag ccaccacgat caggcactcg aattcgacga cgaggggaat       900
     ccggtgggcg cgaccgccgt tctggccgag gcgctcgaga gcgccgaggc cgaaaccctc       960
     gagaccggcg gcgacctctc cgaacccgac atcaccgagc tgaggcgtga gaacccatga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page