(data stored in ACNUC7421 zone)

EMBL: AP011115.PE724

AP011115.PE724       Location/Qualifiers
FT   CDS_pept        complement(757972..759294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07240"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48971"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT39"
FT                   /protein_id="BAH48971.1"
FT                   /translation="MAKRTLVRAAAVLGAASLALAGCSSDSGDDSASGSDSSASATTVS
FT                   TDCTPEEAAAAGAPSTAPLKIGTLLPDTGSLSFLGPPMVAGTQLGVNDVNAAGGVLGQP
FT                   VQLIPGDSGDTTTDTANTTVDRELAAGTQVIIGAASSSVSLKVIDKVSSAGVVMFSPAN
FT                   TSDQFVCYPDKGQYFRTAPTDVLQAQAVSQLISDDGGQRVSILALNDPYGTGLADNIQK
FT                   NLVDAGIPEDQIQKIIYDPNAQSFNSEVDQVKDFAPDAVAVVGFEESAKIITRMHEVGI
FT                   GPSDGMKVYGVDGNMGNALGESVAAPLLDGMQGTTPLTDVGPAFQDRLKAINPGLIDFN
FT                   YAGESYDAVVISALAAEAGKSTAGRDIAANINNVTEGGTPCTSYQECLPLVQAGTDIDY
FT                   NGITGKLDFAAAGEPSIGSYGKLKFGADNKLTTDGYIVVGG"
     atggctaaac ggaccctcgt gcgggcggcc gcggttctcg gcgcggcatc cctcgcactg        60
     gcaggttgta gttcggacag tggcgacgac tccgcgagcg ggagtgacag ctctgcctcg       120
     gccaccactg tttccaccga ctgcaccccc gaagaagcgg cggcggccgg tgccccgtcc       180
     acggcgccgc tgaagatcgg taccctgctc cccgacacgg gaagcctctc cttcctcgga       240
     ccgccgatgg tcgcgggcac ccagctcggc gtcaacgacg tcaacgcggc aggtggggtg       300
     ctcggccagc ccgtccagct gattcccggc gactcgggcg acaccaccac cgacacggcg       360
     aacaccaccg tggaccggga actggccgcg ggcacgcagg tgatcatcgg tgcggcttcg       420
     tcgtcggtgt cgctgaaggt catcgacaag gtgtccagcg ccggcgtcgt gatgttctcc       480
     ccggccaaca cgtccgacca gttcgtctgc tacccggaca aggggcagta cttccgcacc       540
     gcccccaccg acgtgctgca ggctcaggct gtgtcgcaac tcatctcgga cgacggcggt       600
     cagcgcgtgt ccatcctggc gctcaacgac ccgtacggca ccgggctcgc cgacaacatc       660
     cagaagaacc tcgtcgacgc gggcatcccc gaggaccaga tccagaagat catctacgac       720
     cccaacgcgc agtcgttcaa ctccgaggtc gatcaggtca aggacttcgc cccggacgcc       780
     gtcgcggtgg tcggattcga ggagtcggcc aagatcatca cgcggatgca cgaggtcggc       840
     atcggcccgt ccgacggcat gaaggtgtac ggcgtggacg gcaacatggg taacgcgctc       900
     ggcgagtcgg tggccgcacc gctgctcgac ggcatgcagg gcaccacacc gctcaccgac       960
     gtcggcccgg ccttccagga tcgcctcaag gccatcaacc cggggttgat cgacttcaac      1020
     tatgccggtg agtcctacga cgccgtagtc atttccgcgc tcgcggcgga agcggggaag      1080
     tcgacggcgg gtcgcgacat cgccgcgaac atcaacaacg tgaccgaggg cggcacgccg      1140
     tgcacgtcgt accaggaatg cctgccgctc gtgcaggccg gtacggacat cgactacaac      1200
     ggcatcaccg gcaagctcga cttcgccgcc gccggcgagc cgtccatcgg ttcgtacggc      1260
     aagctgaagt tcggtgccga caacaagctg acgacggacg ggtacatcgt cgtcggcggg      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page