(data stored in ACNUC7421 zone)

EMBL: AP011115.PE728

AP011115.PE728       Location/Qualifiers
FT   CDS_pept        762017..762520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48975"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT43"
FT                   /protein_id="BAH48975.1"
FT                   /translation="MELGTVTFTYDGRVALRFQQALSHSPEKVWRVLTDPQYLKAWFPA
FT                   DVDFDLTPGADLVFRVTPEQVRRFGLPADQTTTGTVISVHPAHILEYLWDAETLHWELV
FT                   PDGSGGCWLTLTHTVEEEESAYAHAAGWHAGLEVVEAQLDGREVDWSLWDRADELASSY
FT                   RKTS"
     atggagctcg gcaccgtcac tttcacctac gacgggcggg tagcccttcg attccagcaa        60
     gcgctctcgc actcgccgga gaaggtgtgg cgtgttctca ccgacccgca gtacctgaag       120
     gcctggtttc ccgccgacgt cgacttcgac ctcaccccgg gggccgacct cgtcttccgg       180
     gtgacaccgg agcaggtgcg ccgattcggg ctgcccgcag atcagaccac caccggaacg       240
     gtcatctcgg tgcatcccgc gcacatcctc gaatacctgt gggacgccga gacgctgcac       300
     tgggaactcg ttcccgacgg cagcggcggc tgctggctga cgctcaccca caccgtagag       360
     gaagaagaat ccgcctacgc acacgccgcc ggctggcacg cggggctcga ggtcgtcgaa       420
     gcgcaactgg acggccgcga agtcgactgg tcactgtggg accgggccga cgaactcgcc       480
     tcgtcgtacc gcaagacgtc ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page