(data stored in ACNUC7421 zone)

EMBL: AP011115.PE729

AP011115.PE729       Location/Qualifiers
FT   CDS_pept        762539..763636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48976"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT44"
FT                   /protein_id="BAH48976.1"
FT                   /translation="MRIPDSTTTPAATFVKEVTGEATRRWGVHGTDLGCPVRLADGRVA
FT                   FFFGDTFTSRGRSGTGWRSPVMLRSTTTDLRGGIEFDSAAGGRTAREILPNAHDVRESP
FT                   DRESAGTEFTVVPADAVTIGDRTYLSVVSVHSWAAQAWPTNFTYLAWSDDGGEHWHRTR
FT                   ARWDNHGGSLDQLWTMERHDGYVYVVSSAFDRINPGGMILRRVPEARILEPGAYEDWGW
FT                   DRGTGWAWGQPATPILPGPVGEMCLRQIDGTWVLAYFDPTAYAIVTRTARRIDGPWSEP
FT                   TVQVAGGGWGAADGTWAQIYGGYIHPASTRDELHLLVSQWNTTTGDPYRVLQFTTPLDP
FT                   PVTPRAPTPTTALPLRVPHRGNGIG"
     gtgcgtatcc cggacagcac caccacaccg gcagcgacct tcgtcaagga ggtcaccggc        60
     gaggcgacgc ggcgatgggg tgtgcacggc accgacctcg gctgtccggt gcgcctggcc       120
     gacggccggg tcgcgttctt cttcggtgac acgttcacgt cccgcggccg gagcggcaca       180
     gggtggcgca gtcccgtcat gttgcgctcc accacaaccg atctccgcgg cggcatcgaa       240
     ttcgactccg cggcaggtgg ccggacggcg agggagatcc tcccgaacgc gcacgacgtc       300
     cgcgaatcac ccgaccggga atcggcgggc accgagttca ccgtcgttcc cgcggacgcc       360
     gtcacgatcg gcgaccggac ctatctgtcc gtcgtcagcg tgcactcgtg ggcggcacag       420
     gcatggccga cgaacttcac gtatctcgcc tggtccgacg acggcggcga gcactggcac       480
     cggacccgcg cacgctggga caaccacggc gggtcgctcg accaactgtg gaccatggaa       540
     cggcacgacg gctacgtcta cgtcgtctcc agcgcattcg accgcatcaa tccgggcggg       600
     atgatcctgc gccgggtccc cgaggcgcgc atcctcgaac ccggggccta cgaagactgg       660
     ggctgggacc gcggcacggg ctgggcctgg ggacagcccg cgaccccgat cctgccgggc       720
     cccgtcgggg agatgtgcct gcggcagatc gacggcacct gggtcctggc ctacttcgac       780
     cccacggcgt acgcgattgt cacccgcacg gcgcgccgca tcgacggacc gtggtcggaa       840
     ccgacggtgc aggtcgccgg cggcggctgg ggagccgcgg acggcacgtg ggcgcagatc       900
     tacggcggct acatccaccc ggcgtccacg cgggacgaac tgcatctgct tgtgtcgcaa       960
     tggaacacga ccaccgggga tccctaccgc gtgctgcagt tcaccacccc gctggacccg      1020
     cccgtcaccc cacgagctcc gactccgacc accgcccttc cccttcgagt tccacaccgc      1080
     gggaatggaa ttggttga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page