(data stored in ACNUC7421 zone)

EMBL: AP011115.PE736

AP011115.PE736       Location/Qualifiers
FT   CDS_pept        complement(774485..775324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48983"
FT                   /db_xref="GOA:C1AT51"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT51"
FT                   /protein_id="BAH48983.1"
FT                   /translation="MTEPGKASDESGTGASDDAPKVDLGKSSDGTENSSDSSLPPEFGS
FT                   PFDYDATAEASLSQPPATSDATPSPGASGTGPGWDTYSGVGNGPGWGSTPTYPPPGGTE
FT                   PTAPFPNVGESTSPTAPYSGYDKPQQPDGPTYGAPDPAYGAQYGAAPQPPQDYQQPGYQ
FT                   QPAYGQQQGYPQQGFPPPGYAPGYNAYADPSAPFGRHPLTGEPYSDKSKLTAGLLQIFL
FT                   GAFGVGRFYLNQPGIAVAQIAVTWLTCGIGGIWPLVDGIMMLTGSVKDQYGRPLRDQ"
     atgactgaac cggggaaagc atccgacgag tccggcacgg gtgcatccga cgacgcaccc        60
     aaggtcgatc tgggaaagag cagcgacggc acggagaaca gcagcgactc gagcctgccg       120
     cccgagttcg gctcgccctt cgactacgac gccaccgccg aggcctcgct gtcgcagcct       180
     cccgccacgt ccgacgcgac gccgtcaccg ggtgcgtccg gaacgggacc gggctgggac       240
     acgtattcgg gtgtcggcaa cggcccgggc tgggggtcga cgcccaccta cccgccgccg       300
     ggcggaaccg agccgacggc cccgttcccg aacgtgggcg agtcgacgtc gccgaccgcg       360
     ccgtactccg gatacgacaa gccccagcag ccggacggtc cgacctacgg cgcaccggat       420
     cccgcttacg gcgcgcagta cggggcggct ccgcaaccac cgcaggacta ccagcagccc       480
     ggataccagc agccggcgta cggacagcag cagggttatc cccagcaggg gttcccgccg       540
     cccgggtacg cccccggcta caacgcgtac gccgatccgt cggcgccgtt cggcaggcac       600
     ccgctgacgg gtgagccgta ctccgacaag tccaagctga ccgccggtct gctgcagatc       660
     ttcctcggcg cgttcggcgt cgggcggttc tacctgaacc agcccggcat cgccgtggcg       720
     cagatcgccg tcacgtggct cacctgtggg atcggcggca tctggccgct ggtcgacggc       780
     atcatgatgc tgacggggag cgtgaaggac cagtacggac ggccgttgcg ggatcagtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page