(data stored in ACNUC7421 zone)

EMBL: AP011115.PE741

AP011115.PE741       Location/Qualifiers
FT   CDS_pept        complement(779423..780127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07410"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48988"
FT                   /db_xref="GOA:C1AT56"
FT                   /db_xref="InterPro:IPR011746"
FT                   /db_xref="InterPro:IPR019051"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT56"
FT                   /protein_id="BAH48988.1"
FT                   /translation="MSDASEPAREPARAGRRRSMFAVLLLAVAAVCLWGASRMTWVEVT
FT                   SSDGLGEERTSVLVGGTWAAALTPLALTLVAAIAASFAVKGWALRVLGVLVAVVAVAAA
FT                   VPAVGLLVSGASDDEAARLAELPGRAEVQSVSVHAAPAVLVLVGALAALAAAVELVRRP
FT                   RVRAGLSSKYDSPGARRDAAKKTGADSAGEPVTQRMLWDALDAGEDPTVDDKKAEPVDQ
FT                   VDGSDEDPGTRT"
     gtgagcgacg cgtcggagcc ggcccgggaa cccgcgcggg cggggcgtcg ccggtcgatg        60
     ttcgcggtgc tgctcctcgc ggtcgccgca gtgtgcctgt ggggtgcctc gcggatgacg       120
     tgggtggagg tcacctcctc cgacgggctg ggcgaggaac gcacgtccgt gctcgtgggc       180
     ggcacctggg ccgcggcgct cacgccgctg gcgctgaccc tggtcgccgc gatcgcggcg       240
     tcgttcgccg tgaagggctg ggccctgcgc gtactgggtg tgctcgtcgc ggtggtggcc       300
     gtcgcggccg cggtcccggc ggtcggactg ctcgtctccg gcgcatccga cgacgaggcg       360
     gcgcggctgg ccgagttgcc gggcagggcg gaggtccagt cggtgtccgt gcacgccgca       420
     cccgccgttc tcgtgctggt gggcgccctg gcggcgctcg ccgccgcggt ggagctggtc       480
     cgcaggccgc gggtgcgggc ggggctgtcc tccaagtacg acagccccgg tgcaaggcgg       540
     gacgcggcga agaagaccgg tgccgattcg gcgggcgagc ccgtcaccca gcgcatgctc       600
     tgggacgccc tggacgcggg ggaggacccc acggtggacg acaagaaagc cgaacctgtc       660
     gaccaagttg acggttcgga cgaagacccg ggtacccgga cgtaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page