(data stored in ACNUC7421 zone)

EMBL: AP011115.PE744

AP011115.PE744       Location/Qualifiers
FT   CDS_pept        complement(782222..783001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48991"
FT                   /db_xref="GOA:C1ATY3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C1ATY3"
FT                   /protein_id="BAH48991.1"
FT                   /translation="MTNAMPALFLSHGAPPLVDSDLWVSQLAKWAGDLPRPTAILMVSA
FT                   HWESAPLTIGSTTTGTPLVYDFGGFPERFYRTTYESPGAPELAAQVVSLMPDDETVSHQ
FT                   PHRGLDHGAYVPLTVMYPDADIPVLQISLPTLDPQRLLHLGERLRPLREQGVLIVGSGF
FT                   TTHGLPFLRDPSPDATAPGWSSEFDAWADERLAAGDVDSLIDFRSLAPGMPYAHPTIEH
FT                   FAPLFVTLGASSDPEQIPRQVIDGFWMGLAKRSIQVA"
     atgaccaacg ccatgcccgc cctgttcctc agccacggtg cgccgccgct ggtggacagt        60
     gacctgtggg tgtcgcagct ggcgaagtgg gcgggcgacc tgccacggcc cacggccatt       120
     ctcatggtgt cggcgcactg ggaatcggcg ccgctcacga tcggatccac caccaccggc       180
     acgcccctcg tctacgactt cgggggcttc cccgagcggt tctaccggac gacgtacgag       240
     tcgcccggcg cccccgagct cgccgcgcag gtcgtgtcct tgatgccgga cgacgagacg       300
     gtgtcgcacc agccgcaccg cgggctcgac cacggcgcct acgtgccgtt gacggtcatg       360
     tatcccgacg ccgacatccc ggtcctccag atctcgctgc cgaccctcga cccgcaacgg       420
     ctgctgcacc tcggtgagcg gctgcgcccc ctgcgcgagc agggcgtgct gatcgtcggt       480
     tccgggttca ccacccacgg actgccgttt ctgcgcgacc cctcacccga cgcgacggcg       540
     ccgggctggt cctccgagtt cgacgcctgg gcggacgagc gtctcgccgc gggcgacgtg       600
     gactcgctga tcgatttccg ctcgctcgcg ccggggatgc cgtacgcaca ccccacgatc       660
     gagcacttcg cgcccctctt cgtcacgctc ggcgcgtcga gcgaccccga gcagattccc       720
     cggcaggtga tcgacggctt ctggatggga ctggccaagc ggtcgattca ggtggcctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page