(data stored in ACNUC7421 zone)

EMBL: AP011115.PE78

AP011115.PE78        Location/Qualifiers
FT   CDS_pept        69778..70260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00780"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48325"
FT                   /db_xref="GOA:C1AS76"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS76"
FT                   /protein_id="BAH48325.1"
FT                   /translation="MTTPTPDSSATAPTPGTALQRARSDPAYGAFLLLRIGFTVLPIVM
FT                   GIDKFTNVLTTWEDYLAPWIVDLSPFSAHQTMLVVGVIEIVVGIAVAIKPRYAAYIVAA
FT                   WLAGIVINLLSYPGFYDVALRDFGLMLAALTLGRLAYVYDPAWHRRTALAPKLSAA"
     atgactactc ccacgcctga ctcgtcggcg accgcaccca cacccggaac ggccctgcaa        60
     cgcgctcgca gtgaccccgc ctacggcgcg ttcctgttgc tgcggatcgg attcaccgtg       120
     ctcccgatcg tcatgggcat cgacaagttc acgaacgtgc tcaccacctg ggaggactac       180
     ctggcgccgt ggatcgtcga cctcagcccg ttcagcgcgc accaaaccat gctggtcgtc       240
     ggagtgatcg aaatcgtcgt cggcatcgcc gtcgcgatca aaccacgata tgcggcctac       300
     atcgtcgccg cctggctcgc tggaatcgtc atcaacctgc tgagctaccc cggcttctac       360
     gacgttgcac tgcgtgactt cggactgatg ctcgccgccc tcaccctcgg ccggttggcc       420
     tacgtgtacg acccggcctg gcaccggcgc accgcactcg ccccgaaact gagtgccgcc       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page