(data stored in ACNUC7421 zone)

EMBL: AP011115.PE80

AP011115.PE80        Location/Qualifiers
FT   CDS_pept        complement(71131..71700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48327"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS78"
FT                   /protein_id="BAH48327.1"
FT                   /translation="MWSPVGGGGEAMLLSVGHGRLGREELTTLLNRAGVDAVVDIRRYP
FT                   GSRRNRDVGSEMMTHWLPDAGIGYRWESRLGGRRRLSPGEPREDPWWQVDQFAAYAAHT
FT                   RTTEFAVALTELLDRAARQRTAMMCSESVWWRCHRRLVADVAVLRRGVSVEHLMHDGRR
FT                   TPHLPAEGARVRADGQVVWDRHRARS"
     gtgtggtctc cggtgggcgg aggtggtgag gcgatgttgc tgtccgtggg acacggccgg        60
     ctcggtcggg aagaactgac gacactgctg aaccgcgccg gtgtcgacgc ggtggtcgac       120
     attcgccggt atcccggcag tcgccgcaat cgcgatgtcg gcagcgagat gatgacgcac       180
     tggttaccgg acgccggaat cggctatcgc tgggagtcgc gactgggcgg tcgccgccgc       240
     ctgtcgcccg gcgagccgcg tgaggacccc tggtggcagg tcgatcagtt cgccgcctat       300
     gccgcccaca cccgcaccac cgagttcgcc gtggcgctga ccgagttgct ggatcgggcg       360
     gcgcggcagc gaacggcgat gatgtgcagt gagagcgtgt ggtggcggtg ccaccgccgg       420
     ctcgtcgccg acgtcgcagt cctgcggcgc ggggtgagcg tcgagcacct catgcacgac       480
     ggccggcgca ccccgcacct cccggcggag ggcgcccggg tgcgggccga cggccaggtg       540
     gtctgggacc gccaccgggc gcggtcctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page