(data stored in ACNUC7421 zone)

EMBL: AP011115.PE85

AP011115.PE85        Location/Qualifiers
FT   CDS_pept        74833..75279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00850"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48332"
FT                   /db_xref="GOA:C1AS83"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS83"
FT                   /protein_id="BAH48332.1"
FT                   /translation="MTEVARYTQLILPVFWLGMVVAISFLEAPIKFRAPGVTLAIGLGI
FT                   GRKVFLALNAVELVLALALLASCVAAPPGATALTVLALVTVVLVVQIAVVRPPLSKRSD
FT                   RILAGEHLPRSRIHLVYIGLEVAKVALLIALIFQLFRAVASCLH"
     atgactgagg tggcgcgcta cacgcagttg atcctgccgg tcttctggct cgggatggtg        60
     gtggcgattt cgtttctcga ggcgccgatc aaatttcggg ccccgggcgt gaccctggcc       120
     atcgggctcg ggatcggccg gaaggtcttc ctcgcgctca atgcggtgga actggttctg       180
     gcactggcgt tgttggcgtc gtgcgtcgcc gcgccaccgg gcgcaaccgc gttgacggtg       240
     ctcgcgctgg tcacggtggt gctggtggtg cagatcgcgg tggtgcgtcc gcccctgagt       300
     aaacgatcgg accggatcct cgccggagag cacctgccac gatcgaggat acacctggtg       360
     tacatcggac tggaggtggc gaaggtcgca ttgctgatcg cgttgatctt ccagctgttt       420
     cgggcggtgg cctcatgcct tcactga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page