(data stored in ACNUC7421 zone)

EMBL: AP011115.PE86

AP011115.PE86        Location/Qualifiers
FT   CDS_pept        75267..75932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48333"
FT                   /db_xref="GOA:C1AS84"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS84"
FT                   /protein_id="BAH48333.1"
FT                   /translation="MPSLTPGEPTRTDLATRTDIEDVLRRFYGRVLVDDLLAVPFAEIR
FT                   ESGLESRLPIMCDFWETVLFGARLYQGSAGRVHRSVHTRHRFEAWHFLRWLTLWSTTVG
FT                   QMFHGPSAAHATVHATRIARAMHRNLTGTDSAELDALTTREPHRVRDDHPSDRSPGGDL
FT                   DDGTASHRRVHGEATDLPEDHHTPRRTDQTVAADKPPGVASVDSDGPRRRIRKEVLQP"
     atgccttcac tgacaccagg cgaacctacg cgcacggatc tggccactcg caccgacatc        60
     gaggacgtgc tccgccggtt ctatgggcgc gtgctcgtcg atgacctcct cgccgtcccg       120
     ttcgccgaga tccgggagag cgggctcgaa tcacgcctgc cgatcatgtg cgacttctgg       180
     gagaccgtcc tgttcggggc ccgcctctat cagggcagcg ccgggcgggt gcaccggagc       240
     gtccacaccc ggcatcgatt cgaggcatgg cacttcctcc gatggctcac cctctggtcc       300
     accacggtcg ggcagatgtt tcacggtccg agcgccgcac acgccacagt ccacgccacc       360
     aggatcgccc gggcgatgca ccgcaacctg accggcaccg actccgccga actcgatgcc       420
     ctcaccaccc gagaacccca tcgggtccgc gatgaccacc catctgatcg ctcccccgga       480
     ggtgacctcg atgacggaac ggcgtctcat cgccgggtgc acggtgaggc cacggatctc       540
     ccggaagacc accacactcc gcgccgaaca gaccagacag tggccgcaga caagcccccc       600
     ggggtagcca gcgtcgactc ggatggtccg cggcgcagaa tacgaaagga agtgcttcaa       660
     ccgtga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page