(data stored in ACNUC7421 zone)

EMBL: AP011115.PE87

AP011115.PE87        Location/Qualifiers
FT   CDS_pept        75929..76240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48334"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS85"
FT                   /protein_id="BAH48334.1"
FT                   /translation="MNEKTWSVNIVIDEHKSAETGAQTRARARLRTSGRAAFVGTGLAR
FT                   RNPHHTDVPEVSDDMAAARALADLSHQLYEAAAQREAVTRSALTSARAADFGRRRSSA"
     gtgaacgaga agacatggtc ggtgaatatc gtcatcgacg aacacaaatc ggcggagacc        60
     ggggcccaga cacgagcgag ggcccgtctg cggaccagcg gccgggccgc attcgtggga       120
     acgggactcg cacggcgcaa cccgcaccat accgacgtcc cggaggtcag cgacgacatg       180
     gccgctgccc gcgccctggc agacctgtcg catcaactgt acgaagcagc cgcccagcgc       240
     gaagcggtca cgcgcagcgc gctcacctcc gcacgcgccg ccgacttcgg ccgtcgacgt       300
     tcctcggcct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page