(data stored in ACNUC7421 zone)

EMBL: AP011115.PE88

AP011115.PE88        Location/Qualifiers
FT   CDS_pept        76333..76743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48335"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS86"
FT                   /protein_id="BAH48335.1"
FT                   /translation="MSEHLFHIALADDWEGAARFGEYEASTRAHTLDQIGFIHAATAEQ
FT                   LEHVLATVYGDVNLPLAVIVIDQDALRDAGVDVRWDERAGPSDTPGRWVPRIMGAVPLD
FT                   PDIVVATIPLEKHGENWTVPDLSGYSVDEAAS"
     atgagcgaac atctctttca catagccctc gccgacgact gggaaggcgc cgcacggttc        60
     ggagaatacg aagcgtccac ccgcgcccac acactcgatc agatcggatt catccacgcc       120
     gcgaccgcgg agcaactcga gcacgtcctc gccaccgtct acggtgacgt caatcttccc       180
     ctggcggtga ttgtgatcga ccaggacgca ctccgcgatg ccggcgtcga cgttcgctgg       240
     gacgagaggg cgggaccgtc ggatacgccc ggtcggtggg ttccgcggat catgggagcg       300
     gtgccgctgg atccggacat cgttgtggcg accatcccgc tcgagaaaca cggtgagaat       360
     tggaccgtcc ccgacctctc cgggtacagc gtcgacgagg cggcgtcgta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page