(data stored in ACNUC7421 zone)

EMBL: AP011115.PE89

AP011115.PE89        Location/Qualifiers
FT   CDS_pept        complement(77092..77880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48336"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS87"
FT                   /protein_id="BAH48336.1"
FT                   /translation="MKGDEVDEASDARGPRRNFLPRNRQRERVLRMVREHEGAVDAVEL
FT                   ASQIGVHVTTVRFHLDALCDDGAITRTRMNRPGAGRPRTGYLAIEERVDYRTLADVLAM
FT                   ELGQTVQTRARRAEHAGHEWATRMAASRSAGTGDGGHTPESDAGDALDHAAARTTNAFA
FT                   RMGFGPELVSAPDPSTPPSADSGGPAGERERIIRLHACPVRDLARSHPEVVCGVHRGLL
FT                   QGLLNTSTTEGNRKPHQPALSAHLEPFVEPELCVARLVAG"
     atgaaaggtg acgaggtgga cgaggcaagc gatgcccggg ggccgcggcg aaatttcctg        60
     ccgcgcaacc ggcaacggga acgtgttctt cggatggtgc gtgagcacga gggtgcggtg       120
     gacgccgtcg aactggcatc acagatcggt gtgcacgtga cgacggtgcg gttccatctg       180
     gacgcgctgt gtgacgacgg tgcgatcaca cgtacccgga tgaaccggcc gggcgcgggc       240
     cggccccgta ccggctatct ggcgatcgag gaacgcgtgg actaccggac tctcgccgac       300
     gtcctcgcga tggagttggg ccagacggtg cagacgcggg ctcgccgcgc ggagcatgcc       360
     gggcacgaat gggccacgcg gatggcggct tctcgcagcg caggcaccgg tgacggcggg       420
     cacaccccgg agtcggatgc cggtgatgcg ctcgatcatg cggcggcgcg caccacgaat       480
     gctttcgcgc ggatggggtt cggccccgag ctggtctcgg cgccggaccc gtcgacaccg       540
     ccgtcggcgg acagcggcgg ccccgcgggc gaacgtgaac ggatcattcg cctgcacgcc       600
     tgcccggtac gggatctggc ccggtcgcat cccgaggtgg tgtgcggagt gcatcggggg       660
     ttgctgcagg gtctgctgaa cacgtcaacg accgagggaa accgaaagcc gcatcaaccg       720
     gccctctctg ctcaccttga gccgttcgtc gaacccgaac tgtgcgtggc caggctggtg       780
     gcggggtga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page