(data stored in ACNUC7421 zone)

EMBL: AP011115.PE91

AP011115.PE91        Location/Qualifiers
FT   CDS_pept        78917..79477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48338"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS89"
FT                   /protein_id="BAH48338.1"
FT                   /translation="MDASKATPSTSRGLRLRLKPVQSRGFVQGAWWPRSTHLTDELPAL
FT                   LTALSRRLGHIDRIIYDENGWAPAPSRIDHAGNTVDLRHSSDQSSNTLAITGEKFGRLV
FT                   LLVVPPYTDPVFAYATIMTAASPRDVSTADELLAIGAREAEDRRLALRAQHRWESEGGA
FT                   LHHRGDKSVRPRRTGDSDRVRHG"
     gtggatgcct cgaaggcgac accctcaacc agtcgaggtc tgcgattgcg gctcaagccc        60
     gtccagtccc gcggattcgt acagggcgcc tggtggccac gatcgactca cctcaccgat       120
     gaacttccgg ccctactcac ggccctctcg cggcggctgg gccacatcga ccggatcatc       180
     tacgacgaga acggctgggc gccagcaccg tcgcgtatcg accacgcagg caacacggtg       240
     gacctacgac actccagcga ccagtcgagc aatacactgg cgatcaccgg cgagaagttc       300
     ggacggctgg tcctgctggt ggtccctccg tacaccgacc cggtcttcgc ctacgcgacc       360
     ataatgacgg cggcgagtcc gcgcgacgtc tccaccgccg acgaactgct ggcgatcggt       420
     gcacgcgagg ccgaggatcg ccggctggca ctgcgcgccc aacaccgctg ggagtccgaa       480
     ggcggagcac tacaccaccg aggagacaag tctgtgcggc cgcgccgcac cggcgacagc       540
     gaccgggtgc gacacggctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page