(data stored in ACNUC7421 zone)

EMBL: AP011115.PE92

AP011115.PE92        Location/Qualifiers
FT   CDS_pept        80188..80616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48339"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS90"
FT                   /protein_id="BAH48339.1"
FT                   /translation="MGIVHGRSVLAAGLGITVELIDLLRYPAGVELRLALTAYGHAAQQ
FT                   ARYETRPLTDPGDPSPRWSFLRTHVRAGDLTGEADPYQAPILSTGTTRLIDFRTTPRYW
FT                   IDGIPAPVSLMVTVEWARIGLAATSSTIEIGPVPHPLP"
     gtgggtattg ttcacgggcg ttccgttctc gccgcgggcc tcgggatcac cgtcgaactc        60
     atcgaccttc ttcgctaccc ggccggggtg gaactgcgtc ttgccctcac cgcttacggg       120
     cacgcggccc agcaggcacg ctatgaaaca cgaccgctga ccgatcccgg ggatccgtcg       180
     ccgcggtggt cgttcctccg aacgcatgtg cgcgccgggg atctcacagg agaggccgac       240
     ccgtaccagg ccccgatcct gtcgaccgga acgacgcggt tgatcgactt ccgcactacg       300
     ccgcggtact ggatagacgg aatcccggcg ccggtgtcgc tcatggtgac cgtggaatgg       360
     gcccggatcg gcctggcggc aacgtcgtcg acgatcgaga tcgggcccgt accccacccg       420
     ctcccctag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page