(data stored in ACNUC7421 zone)

EMBL: AP011115.PE93

AP011115.PE93        Location/Qualifiers
FT   CDS_pept        complement(80671..80919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48340"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS91"
FT                   /protein_id="BAH48340.1"
FT                   /translation="MVTGWCEQVTRAFRWRIEHDHRELKPVLGLDHYDEPSWLGGHHHA
FT                   ALVTAAHLFLATLRLTHPNSVRQNRPATPPAANVHAH"
     gtggtcaccg gctggtgcga acaggtcaca cgtgcgttcc gatggcgcat cgagcacgac        60
     caccgggaac tgaaacccgt tctcggactg gaccattacg atgagccctc ctggctcggc       120
     ggacaccacc acgccgccct ggtcaccgcc gcccacctct tcctcgccac cctgcgattg       180
     actcacccaa attcggttcg gcagaaccgg cccgctacgc cacccgccgc gaacgtccac       240
     gcgcactga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page