(data stored in ACNUC7421 zone)

EMBL: AP011115.PE96

AP011115.PE96        Location/Qualifiers
FT   CDS_pept        82395..82679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48343"
FT                   /db_xref="GOA:C1AS94"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS94"
FT                   /protein_id="BAH48343.1"
FT                   /translation="MSTALYFAGLSLIGIGGLGDGLIRGLNPSAHPGTHKVSMGLALAG
FT                   VLCWTVGAVVSDQPLWWKIVASVFVLTIGFLLTMRSRFLPSHQWCEPDE"
     gtgagcaccg cgctgtactt cgccggactc agcctcatcg gcatcggagg actgggcgac        60
     ggcttgatcc ggggattgaa cccgtccgct caccccggca cacacaaggt ctcgatgggc       120
     ctggccctgg ccggcgtcct ctgctggact gtcggggccg tcgtgtccga tcagccgtta       180
     tggtggaaga tcgtcgcctc cgtcttcgtg ttgacgatag gttttctcct gaccatgcga       240
     tcacggttcc tgcccagtca ccagtggtgc gaacccgacg agtga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page