(data stored in ACNUC7421 zone)

EMBL: AP011115.PEPQ

AP011115.PEPQ        Location/Qualifiers
FT   CDS_pept        complement(587390..588529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="ROP_05700"
FT                   /product="putative Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="protein synonym:prolidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48817"
FT                   /db_xref="GOA:C1ARZ0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ0"
FT                   /protein_id="BAH48817.1"
FT                   /translation="MSSLGASTSRFPTTIYADRIARAGALARDAGLDGLLITPGPDLRY
FT                   LLGSRAESFERLTCLVIPANGDTASVVVPRLELAALTESATSDLGLTVRDWVDGVDPYA
FT                   LVSGLLPSPARTAVTDAMPALHLIPLSEALGALPILATEVLRELRMVKDDAEIDALRRA
FT                   GQAIDRVHARMGEFLKVGRTEAEVAADITAAILEEGHTEAAFVIVGSGPHGADPHHEVS
FT                   ERVVESGDVVVIDIGGPVEPGYNSDSTRTYSMGEPDPGVAEKFAVLEEAQAAAVALVRP
FT                   GVTAEAVDAAARDLLAAQGLAEVFVHRTGHGIGLSVHEEPYIVSGNSIELTEGMAFSVE
FT                   PGIYFRGEWGARIEDIVVVTADGCEPVNTRPHGLTVLPG"
     atgagttccc tcggcgcatc gacttcacgt ttcccgacca ccatctatgc cgaccggatc        60
     gcgcgcgcag gcgctctggc ccgcgacgcc ggactcgacg gcctcctcat cacgcccgga       120
     cccgacctgc ggtatctgct gggttcacgc gcggagtcgt tcgaacgcct cacctgcctg       180
     gtgatcccgg cgaacggcga cacagcgtcc gtggtcgtgc cgcggctcga actggccgcg       240
     ctgaccgaat cggccacgtc cgacctgggt ctgacggtgc gcgactgggt ggacggggtg       300
     gacccgtacg cgctggtgtc ggggctgctg ccgtctcctg cgcggaccgc cgtgacggat       360
     gcgatgcccg cgctgcacct gattccgttg tcggaggcgc tcggggcgct gccgatcctg       420
     gccaccgagg tgctgcggga gctgcggatg gtcaaggacg atgcggagat cgacgcgctg       480
     cgccgggccg gtcaggccat cgaccgggtt cacgcccgga tgggggagtt cctgaaggtc       540
     ggccgcaccg aggccgaggt ggcggccgac atcaccgccg cgatcctcga ggaggggcac       600
     accgaggcgg cgttcgtgat cgtcggatcg gggccgcacg gcgccgatcc gcaccacgag       660
     gtgtccgagc gggtcgtcga gtcgggtgac gtggtggtca tcgacatcgg gggaccggtc       720
     gagcccggtt acaactccga ctccacccgc acgtacagca tgggtgagcc cgatccgggt       780
     gtggccgaga agttcgcggt cctcgaggag gcgcaggcgg cggcggtcgc cctggtgcgt       840
     cccggcgtca ccgccgaggc ggtcgacgcg gccgccaggg acctgctggc cgcgcagggt       900
     ctcgccgagg tgttcgtgca ccggaccggg cacggaatcg gcttgtcggt gcacgaggag       960
     ccgtacatcg tctcgggtaa ttcgatcgaa ctgaccgagg ggatggcctt cagcgtggag      1020
     ccgggaatct acttccgcgg ggagtggggt gcccgcatcg aggacatcgt cgtcgtgacc      1080
     gccgacggct gtgagccggt caacacccgg ccgcacgggc tgaccgttct cccgggctga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page