(data stored in ACNUC7421 zone)

EMBL: AP011115.PHES

AP011115.PHES        Location/Qualifiers
FT   CDS_pept        complement(721323..722408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="ROP_06900"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="protein synonym:pheRS"
FT                   /note="protein synonym:phenylalanine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48937"
FT                   /db_xref="GOA:C1AT05"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT05"
FT                   /protein_id="BAH48937.1"
FT                   /translation="MAKKEGAASAGVEGGAVDASALTEDALTAAAESAEKAFASVADLD
FT                   DLAKAKVEHMGDKSPIALARRGLGALPGKEKADAGKRVNVARTRISAAFDERRAVLLAE
FT                   RDAAVLVAEAIDVTLPSQRQPVGARHPISIISEQVEDVFVAMGWEVAEGPEVETEHFNF
FT                   DALNFLPDHPARTMQDTFHIAPEGSRQVLRTHTSPVQVRTMLSREVPIYVVCPGRTFRT
FT                   DELDATHTPVFSQVEGLAVDKGLTMAHLRGTLDAFARALFGPETRTRMRPNYFPFTEPS
FT                   AEVDVWFPNKKGGAGWVEWGGCGMVNPNVLRASGIDPDVYTGFAFGMGLERTLQFRNGI
FT                   PDMRDIVEGDVRFTLPFGVQG"
     gtggctaaaa aagagggcgc tgcctccgcg ggggtcgaag gcggcgcggt cgatgcgagt        60
     gcgctcaccg aggacgctct gactgcggcg gcggagagcg ccgagaaggc gttcgcgtcg       120
     gtggcggatc tcgacgatct ggcgaaggcc aaggtcgagc acatgggtga caagtcgccg       180
     atcgccctcg cccgccgcgg actgggagcc ctaccgggca aggagaaggc cgacgcgggc       240
     aagcgtgtga acgtcgcccg cacccggatc agcgcggctt tcgacgagcg ccgcgccgtg       300
     ctgctcgccg agcgtgacgc cgccgttctc gtggccgagg ccatcgacgt gacgctgccg       360
     tcgcagcgtc agccggtggg cgcccgccac ccgatcagca tcatttccga gcaggtcgag       420
     gacgtgttcg tggccatggg ctgggaggtc gccgagggtc cggaggtgga gaccgagcac       480
     ttcaacttcg atgccctgaa cttcctgccc gatcaccccg cccggacgat gcaggacacg       540
     ttccacatcg cgcccgaggg ctcgcggcag gtgctccgca cgcacacgtc gccggtgcag       600
     gtgcgcacga tgctctcgcg cgaggtgccg atctacgtgg tgtgccccgg acggacgttc       660
     cgcaccgacg aactcgacgc gacacacacc cccgtcttct cccaggtgga ggggctcgcg       720
     gtcgacaagg gcctcaccat ggcacacctg cgtggcacgc tcgacgcgtt cgcgcgcgcg       780
     ctgttcggtc ccgagacccg cacccgcatg cgtccgaact acttcccgtt cacggaaccg       840
     tccgccgagg tggacgtgtg gttcccgaac aagaagggcg gcgcgggctg ggtcgagtgg       900
     ggcggctgcg gaatggtcaa tccgaatgtg ctgcgcgcct ccggaatcga ccccgacgtg       960
     tacaccgggt tcgcgttcgg gatggggctc gagcgcacac tccagttccg gaacgggatc      1020
     ccggacatgc gcgacatcgt cgagggcgac gtgcgtttca cgctgccctt cggtgtccag      1080
     ggctga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page