(data stored in ACNUC7421 zone)

EMBL: AP011115.PHET

AP011115.PHET        Location/Qualifiers
FT   CDS_pept        complement(718769..721255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="ROP_06890"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="protein synonym:pheRS"
FT                   /note="protein synonym:phenylalanine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48936"
FT                   /db_xref="GOA:C1AT04"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT04"
FT                   /protein_id="BAH48936.1"
FT                   /translation="MRVAQSWLTEILQRATPDWDVTAEELDAGFVRVGLEVEEVDRLEP
FT                   VDGPLVVGKVLEITELTEFKKPIRFCKVDVGAAEPQGIVCGARNFAEGDLVVVALPGAV
FT                   LPGGFAIASRKTYGQVSDGMICSVAELGIGKDHSGILVLEPGTALPGADANELMGLHDT
FT                   VIELNITPDRGYCFSVRGLTRELACGFDLDFADPAAVAPSPADGEAWPIRVEPESKATR
FT                   FAARRVTGIDPNAVSPWWLQRRLLLSGVRPISPAVDVTNYVLLELGQPLHAFDAAKIRG
FT                   ELVVRRAVAGEKLTTLDETERVLDPEDVVIADDSGVLSLAGIMGGASTEVGPGTTDILL
FT                   EAATWDPLAVFKTARRHKLSSEAGKRFERVVDPEIPVAALDRAAALLVDIAGGRVESAL
FT                   TDIGEVTPHRPIHMDIDLPDRVAGVDYPTGTSARRLTQIGCSVEVGVSDSGHGQLVAAP
FT                   PSWRPDLVQPADLVEEVLRLEGLEKIPSVLPAAPAGRGLTPTQRRKRAVGRALAFSGYV
FT                   EILPPVFLPTAVFDTWGLDPEDPRRNTGRVLNPLESDRPELATTLLPGLLEVLARNVSR
FT                   GQRDLSLFGIAQVVLPGADTKPVAALPVDRRPTDEQITALLQSLPDQPVHVAVVLTGQR
FT                   EPSGPWGAGRAADATDAFAAARTVAAAAGVEFEFRAAQYLPWHPGRGAELLVDGVVVGH
FT                   AGELHPAVLERAGLPPRTSAVEIDLSALPLVENLPAPKVSPFPAVLQDVAVVVDTAVPA
FT                   AEVQAALRSGGGELLEDIRLFDVFEGEQVGEGRKSLAFALRFRGADRTLTEDEASAARD
FT                   AAVAAASAAVGAELRS"
     gtgcgagtag cgcaatcctg gctgaccgag atcctgcagc gtgccacccc ggactgggac        60
     gtcaccgccg aggaactcga cgcaggtttc gtccgggtcg ggctcgaggt cgaggaagtc       120
     gaccggctcg agcccgttga cggccccctc gtggtcggca aggttctcga gatcaccgag       180
     ctcaccgagt tcaagaagcc gatccgcttc tgcaaggtgg atgtgggggc ggccgagccg       240
     cagggcatcg tgtgcggcgc ccggaacttc gccgagggcg acctcgtggt ggtcgcgctg       300
     ccgggcgcgg tcctccccgg tggtttcgcc atcgcgtccc gcaagaccta cgggcaggtg       360
     tccgacggga tgatctgctc ggtggccgaa ctgggcatcg gcaaggacca ttcgggcatc       420
     ctcgtcctcg agccgggcac cgcgcttccg ggcgcggacg ccaacgagtt gatgggtctg       480
     cacgacacgg tcatcgaact caacatcacc ccggaccgcg gctactgctt ctccgtccgc       540
     gggctcaccc gcgaactggc ctgcgggttc gacctggact tcgccgaccc cgcagcggtg       600
     gcgccgtctc cggcggacgg ggaggcgtgg ccgattcgcg tcgaacccga gtcgaaggcg       660
     acgcgtttcg ccgcgcgccg ggtgaccggt atcgatccga atgcggtcag tccgtggtgg       720
     ctgcagcggc ggttgctgct gtccggtgtc cgcccgatct cgccggccgt cgacgtcacc       780
     aactacgttc tgctcgaact cggccagccg ctgcacgcgt tcgacgccgc caagatcaga       840
     ggcgaactcg tcgtgcgccg cgcggtggcg ggggagaagc tgacgactct cgacgagacc       900
     gagcgcgtcc tggaccccga ggacgtcgtg atcgccgacg attcgggagt cctgtcgctg       960
     gcaggcatca tgggcggcgc gtccaccgag gtcggacccg gaaccaccga catcctgctc      1020
     gaggcggcca cgtgggatcc gctcgcggtg ttcaagaccg cgcgcaggca caagttgtcg      1080
     agcgaggcgg gcaagcgttt cgagcgcgtc gtcgatcccg agatccccgt cgcggccctg      1140
     gaccgggctg ccgcgctgct cgtcgacatc gccggcgggc gggtcgagtc ggcgctcacc      1200
     gacatcggtg aggtcacccc gcaccggccc atccacatgg acatcgacct ccccgaccgg      1260
     gtggcgggcg tcgactaccc caccggcacc tcggcgcgcc gcctgacgca gatcggctgc      1320
     agcgtcgagg tcggggtcag cgacagcggt cacggtcagc tcgtcgcggc cccgccgtcg      1380
     tggcggcccg acctggtgca gccggccgac ctggtggagg aagtgctccg tctcgagggc      1440
     ctcgagaaga tcccgtcggt gctgcccgcg gcccccgcgg gtcgggggtt gacgccgacg      1500
     cagcgccgca agcgggccgt cggccgcgcc ctggcgttct cggggtacgt cgagatcctt      1560
     ccccccgtct tcctgcccac cgccgtcttc gacacgtggg ggctggatcc ggaggatccg      1620
     cgccggaaca ccggccgggt actcaatccg ctcgaatcgg atcggcccga actggcgacc      1680
     acgctgctgc cgggactgct cgaggtcctc gcccgcaacg tctcccgcgg ccagcgcgac      1740
     ctgtcgctct tcggtatcgc gcaggtcgtg ctgcccggtg cggacacgaa gccggtcgcc      1800
     gcgctgccgg tggaccggcg tccgaccgac gagcagatca cggcgctgct gcagtcgctt      1860
     ccggaccagc ccgtgcacgt ggcggtggtg ctcaccggac agcgtgagcc gagtggtccg      1920
     tggggcgcgg gacgtgctgc cgacgccacc gacgcgttcg ccgcggcccg gacggttgcc      1980
     gccgcggccg gtgtcgagtt cgagttccgc gcggctcagt acctgccgtg gcatccgggc      2040
     cggggcgcgg agcttctcgt ggacggcgtc gtggtcgggc acgcgggcga gttgcacccc      2100
     gcagtgctcg agcgcgccgg acttcccccg cggacgagtg ccgtggagat cgatttgagt      2160
     gctctgccgc tggtggagaa tctgcccgcg ccgaaggtgt cgcccttccc ggcggtcctc      2220
     caggacgtgg cggtcgtcgt cgacaccgcg gttcccgccg ccgaggtcca ggccgccctg      2280
     cgctcgggtg gcggggaact cctcgaggac atccggttgt tcgacgtgtt cgagggcgag      2340
     caggtcgggg agggccggaa gtcgctggcg ttcgcgctgc gattccgggg tgccgaccgc      2400
     actctgaccg aggacgaggc gagcgccgcc cgcgacgctg cggtcgccgc ggcgtccgca      2460
     gcggtgggtg ccgaactgcg cagctga                                          2487
//

If you have problems or comments...

PBIL Back to PBIL home page