(data stored in ACNUC7421 zone)

EMBL: AP011115.PPNK

AP011115.PPNK        Location/Qualifiers
FT   CDS_pept        complement(692234..693196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="ROP_06680"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:poly(P)/ATP NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48915"
FT                   /db_xref="GOA:C1ASY3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASY3"
FT                   /protein_id="BAH48915.1"
FT                   /translation="MSGGSSGGQQREREILLVAHPGRAEITETARRVGKIFERAGIGMR
FT                   VLVDEVDSTRIEPMDGMAADEFLVPGLEVTIVQAGPDAALGCEMVLVLGGDGTFLRAAE
FT                   LAQAASIPVLGINLGRIGFLAETEAEHLDEALGQVVRREYRIEHRMTLDVLVRVDDEII
FT                   ERGWALNEASIENRSRLGVLEVVLEVDGRPVSAFGCDGVLISTPTGSTAYAFSAGGPVV
FT                   WPELEALLVVPSNAHALFARPLVTSPESLIAVETVAGSHDGLVFCDGRRTLELPAGARV
FT                   EVVRGKEPVRWVRLDSAPFADRMVRKFELPVTGWRGRKP"
     gtgagcgggg gaagcagcgg cggccagcaa cgcgagcggg agatcctgct ggtggcgcat        60
     ccgggtcgcg ccgagatcac ggagaccgcg cggcgcgtcg gcaagatctt cgagcgggcc       120
     gggatcggaa tgcgcgtcct cgtcgacgag gtcgacagca cccgcatcga accgatggac       180
     ggcatggccg ccgacgaatt cctggttccc gggctggaag tcaccatcgt gcaggccggc       240
     cccgacgccg ccctcgggtg cgagatggtg ctcgtcctcg gcggggacgg gacgttcctg       300
     cgggcggcgg aactcgctca ggcagcgtcc attccggtcc tgggcatcaa cttgggccgg       360
     atcgggttcc tcgcggaaac agaggccgag cacctcgacg aggcgctcgg ccaggtggtg       420
     cgccgcgaat accgcatcga acaccgcatg acactggacg tgctggtccg ggtggacgac       480
     gagatcatcg aacggggctg ggcgctcaac gaggcgagca tcgagaaccg gtcccggctc       540
     ggtgtcctcg aggtggtgct cgaggtcgac ggcaggccgg tgtcggcgtt cggctgcgac       600
     ggcgtcctca tctccacgcc caccgggtcg acggcatacg cgttctcggc gggcggcccc       660
     gtcgtgtggc cggaactcga ggcgctgctg gtggtcccga gcaacgcgca cgcattgttc       720
     gcgcgccccc tcgtgacgag cccggaatcg ctgatcgcgg tggagaccgt ggcaggcagc       780
     cacgacggcc tggtgttctg cgacggtcgc cggaccctcg aattgcccgc gggcgcccgc       840
     gtcgaagtgg tgcgtggcaa ggaacccgtt cggtgggtac gactggattc ggcgccgttc       900
     gcggaccgga tggtgcgaaa gttcgagctg cccgtcaccg ggtggcgagg aaggaagccc       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page